[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA59402.1"

            "Dihydrouridine synthase TIM-barrel protein yjbN"
            ""

OrgPattern -------------------------------------------------1111--------------1 111-11-11111-111111-111111111111-1111111----11111111111111--1---111111-11111111-11-1----111111111--111111211111111111111111121111111111111111---1-221122211222222222211222122122222221222211--1112222222222222222111122222-113121-----112111111111111111111112111111111133111111111111111111111--11111111-11111111111111111111111111111111111111111111111211111-12111-11--11111111-121-2111211111222222222221222122222111-11121111212122222222222222222222212222211111111111111121111111111111111111-111111-111111112222222222211111112211111222232322233322211222121222111133333333311112232113211-12111-121121121----21111111111111--1-------11-1111333333323233333333333333333333--21212--1---33333333333333333-3333333333333333333333333333333333333333333322233331-333333333333--121111122222323333333332332333333333333333333333333333333333222222222233333233233333222222222211111-1133222222222222111----1---1--------1--------11--111-1-1- 2122445-31323332211111111111111111-11111111111-1111111-11-111-222122222232311-1122222223-14-221321-211266423937374444111-14263-2-6F4-33811--412322221-6--5255444542434-422223342444R7644443441439433334 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLFSYDCKKTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIH:Sequence :HHcTccGGHHHcEEcccHHHHGGcccHHHHHHHHHHHTccEHHHHHHHHHHHHTccEEEE:Sec Str : ========================================:RP:SCP|21->335|1vhnA|2e-62|20.5|297/305|c.1.4.1 : ========================================:BL:SWS|21->336|DUSA_VIBVU|e-124|64.1|315/326 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->316|PF01207|4e-51|43.3|282/303|Dus 61: . . . * . .: 120 :GNRARFLAYHKSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGRFG:Sequence :EEHHHHHHHcHHHHHHHHHHHHHHcTTccEEEEEEEEccHHHHHHHHHHTccEEEEccTT:Sec Str : ##################:PROS|103->121|PS01136|UPF0034|PDOC00874| :============================================================:RP:SCP|21->335|1vhnA|2e-62|20.5|297/305|c.1.4.1 :============================================================:BL:SWS|21->336|DUSA_VIBVU|e-124|64.1|315/326 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->316|PF01207|4e-51|43.3|282/303|Dus 121: . . + . . .: 180 :ACLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEQDSYEALDHFISTVAQAGCRTFIIH:Sequence :ccHHHHHHHHHHHHHHHHHHHHTTcEEEEEEccccccccccHHHHHHHHHHHcccEEEEc:Sec Str :# :PROS|103->121|PS01136|UPF0034|PDOC00874| :============================================================:RP:SCP|21->335|1vhnA|2e-62|20.5|297/305|c.1.4.1 :============================================================:BL:SWS|21->336|DUSA_VIBVU|e-124|64.1|315/326 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->316|PF01207|4e-51|43.3|282/303|Dus 181: . * . . . .: 240 :ARKAWLQGLSPKENREKPPLRYDVVRTIKQDFPQLTVIINGGITTLEEISEHLELLDGVM:Sequence :cccccHHHTccccccccccccHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHTTccc:Sec Str :============================================================:RP:SCP|21->335|1vhnA|2e-62|20.5|297/305|c.1.4.1 :============================================================:BL:SWS|21->336|DUSA_VIBVU|e-124|64.1|315/326 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->316|PF01207|4e-51|43.3|282/303|Dus 241: + . . . . *: 300 :IGRAAYHNPYLLAQVDRNFYGDFHPFLTRHEIIEAFLPYVAEQLVQGVYLNHMTRHILGL:Sequence :TTcccccHHHHHHHHHHTEEEEEEcccccHHHHHHHHHHHHHHHHHcTTcccHHHHHHHH:Sec Str :============================================================:RP:SCP|21->335|1vhnA|2e-62|20.5|297/305|c.1.4.1 :============================================================:BL:SWS|21->336|DUSA_VIBVU|e-124|64.1|315/326 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->316|PF01207|4e-51|43.3|282/303|Dus 301: . . . . + .: 360 :FQGQPGARAWRRHLSENAHRPGAGIEIIREALRQMPC :Sequence :HHHHHHHHHHHHHHHTcTTcccTcccccHHHHHHHcE :Sec Str :=================================== :RP:SCP|21->335|1vhnA|2e-62|20.5|297/305|c.1.4.1 :==================================== :BL:SWS|21->336|DUSA_VIBVU|e-124|64.1|315/326 :$$$$$$$$$$$$$$$$ :RP:PFM|23->316|PF01207|4e-51|43.3|282/303|Dus