[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA59402.1 noce0 ABA59402.1 "Dihydrouridine synthase TIM-barrel protein yjbN"
MLFSYDCKKTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIH
GNRARFLAYHKSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGRFG
ACLMAEPELVAECVAAMAQATQIPVTVKTRIGIDEQDSYEALDHFISTVAQAGCRTFIIH
ARKAWLQGLSPKENREKPPLRYDVVRTIKQDFPQLTVIINGGITTLEEISEHLELLDGVM
IGRAAYHNPYLLAQVDRNFYGDFHPFLTRHEIIEAFLPYVAEQLVQGVYLNHMTRHILGL
FQGQPGARAWRRHLSENAHRPGAGIEIIREALRQMPC
//