[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA59415.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------1-111--11-1--------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------111--------------1---------------------------------111-1-1--1111-1----------------------1--11-------12----1111-221----2-22-22---1---------------------------------------------------------------------------------------------------------1---------------------------------------------------------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRKKESLVGVGLAALTLAVSLPLGATEMPQTMEEMWRIIQQQQQEIEALKAKSQPLETEK:Sequence : XXXXXXXXXXXXXXXX :SEG|6->21|slvgvglaaltlavsl : XXXXXXXXXX :SEG|38->47|iiqqqqqeie 61: . . . * . .: 120 :AHPEISKEVPEKTKEATKTTTSTSEENAETKAQVKELEHKTGVLAEAVESLRTAMHIPEE:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|71->92|ektkeatktttstseenaetka : ==================:BL:SWS|103->466|Y1259_AQUAE|4e-64|41.5|352/100 121: . . + . . .: 180 :FEYKSMYGLGPAASKVYQVGKGLSIGGYGEGRYQTFVNGDGDDNADFARLVLYTGYKFTD:Sequence :============================================================:BL:SWS|103->466|Y1259_AQUAE|4e-64|41.5|352/100 181: . * . . . .: 240 :RIIFNSEIEFEHGTTGEGAEEKGEVSVEFAALDFFLDPRVNIRAGLVLMPMGFINLIHEP:Sequence : XXXXXXXXXXXXXXXX :SEG|189->204|efehgttgegaeekge :============================================================:BL:SWS|103->466|Y1259_AQUAE|4e-64|41.5|352/100 241: + . . . . *: 300 :PFFFGNNRPEVERRIIPSTWREIGVGLFGELLPGLTYTMYGVNGLNAEEFSSRGIRDGRQ:Sequence :============================================================:BL:SWS|103->466|Y1259_AQUAE|4e-64|41.5|352/100 301: . . . . + .: 360 :SGSKALAEDLAFVGRMDYAPPGMPGLSFGGSAYAGNSGQDQSYGGQDLDVFTQLYEGHLQ:Sequence :============================================================:BL:SWS|103->466|Y1259_AQUAE|4e-64|41.5|352/100 361: . . . * . .: 420 :WQYRGWWLRALGAWGHIGDAEALSAAKGETIGESNFGWYTELAYNLLPLVWPETIQYLAP:Sequence :============================================================:BL:SWS|103->466|Y1259_AQUAE|4e-64|41.5|352/100 421: . . + . . .: 480 :FFRFEQLNTIASAPAGFSDKGGINQDIYQVGINYKPIPNVVIKADYRNFVGRDGNPSAAD:Sequence :============================================== :BL:SWS|103->466|Y1259_AQUAE|4e-64|41.5|352/100 481: . * . . . .: 540 :EFNLGLGFIF :Sequence