[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA59494.1"

            "1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase"
HIS4_NITOC  "RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase;         EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase;"

OrgPattern ---2--2122222222-2222222222222222223314333222222322222-2-222-2----12 2121222222222222222-22222222222221112222222222222222222222--122121222222222222--22222222222222-----2-222222222---------------111111111111222233322222322222222223222222222223222222233222222222222222222222222222222222222222122221122221-22222222222222222-2----22-2---22--21----2-222-------222------------------------2----2----22-2222222-2-2222222---2-2--2212222222222222222--12122222-----222222322222222222222222123222222222-2222222222222222122222221322222222222221222-----------------------------222222222222222222222222222222222222222222222222222222222222222222222222222221322-222222222-2223223222222223342222233332-2-------22222221122222212221111122111111121112--222211111111222222222222222-2222222222222222222222222222222222222222222222222221-11111111111111-2-----222322321221222-2221---2222222222222323222222222222222--------222222222222224112222222211112222223322--------------------------------------2--2-222221 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1---------1--1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQP:Sequence :cEEEEEEEEETEccTTcHHHHHHHHTTccHHHHHHHHHHHHTTccEEEEEcccGGGccHH:Sec Str : ===========================================================:RP:SCP|2->241|1qo2A|2e-70|29.1|237/241|c.1.2.1 :============================================================:BL:SWS|1->249|HIS4_NITOC|e-141|100.0|249/249 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->231|PF00977|4e-30|36.6|224/229|His_biosynth 61: . . . * . .: 120 :VNADIIYHIAQALPDMDIQVGGGIRDSDTIQTYLDAGVRYAIIGTKAINAPHFVADACLE:Sequence :HHHHHHHHHHHHcGGTcccEEEEcccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->241|1qo2A|2e-70|29.1|237/241|c.1.2.1 :============================================================:BL:SWS|1->249|HIS4_NITOC|e-141|100.0|249/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->231|PF00977|4e-30|36.6|224/229|His_biosynth 121: . . + . . .: 180 :FPGHILLGLDAREGKIAINGWSKLSRHNLIDIAQRFEKDGVEAIIYTDIQRDGMMKGVNI:Sequence :HccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHTTcTcEEEEcccccGGGTccHH:Sec Str :============================================================:RP:SCP|2->241|1qo2A|2e-70|29.1|237/241|c.1.2.1 :============================================================:BL:SWS|1->249|HIS4_NITOC|e-141|100.0|249/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->231|PF00977|4e-30|36.6|224/229|His_biosynth 181: . * . . . .: 240 :EATSELAKAINIPVIASGGVSSLTEIEALCQHEQDGIGGAIIGRALYEEKIQLAEALAIA:Sequence :HHHHHHHHHHHTTccccccGGGTTccccHHHHHHHHHHHHHHTTcEcTTcHHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->241|1qo2A|2e-70|29.1|237/241|c.1.2.1 :============================================================:BL:SWS|1->249|HIS4_NITOC|e-141|100.0|249/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->231|PF00977|4e-30|36.6|224/229|His_biosynth 241: + . . . . *: 300 :KRLSGESTA :Sequence :HHHTTccc :Sec Str := :RP:SCP|2->241|1qo2A|2e-70|29.1|237/241|c.1.2.1 :========= :BL:SWS|1->249|HIS4_NITOC|e-141|100.0|249/249