[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA59517.1"

            "ATP synthase F1, alpha subunit"
ATPA_NITOC  "RecName: Full=ATP synthase subunit alpha;         EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha;AltName: Full=ATP synthase F1 sector subunit alpha;"

OrgPattern 22222222222222221212222222222222222222222222222622442122222221221222 3333222222222222222-22222222222222222222322232223223232222222232322222222222222222233733333311111112111111112122222223233333443222224224222222222344224422222222222422222222222222222222222244233333333333333333333333333333333335555553322222222222222222222422222222222222222222222222222222422422444242424444444444444422222222233333555555555535335444755443553333333353333333544335333332222535353333433433333333333-4444434444324333445333333233353364663332222222223352363222222222222222322222222221222223333444354446547575446588893834843332233433433342543335433363222222235523333523553335444433333357766563252333323333333333333333353222352333335353534355433343344443222533333133343344353553333233-543344333353523322322244444555555555555555532334334635666665565652242222223555428352222222222222222222222222534434333353333345422222222233336333337653333444444452222223533333333323323356----2-34342423336322654433233353353432 3444334-C6523444356433344453333333333333233343244444423443444444343423334434334434444334-354344444434449CB235394758624133453642626l5-4543423723663412243364B34646A45445955A47556445l4463399CG4A63343434 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN:Sequence : ===================================:RP:SCP|26->96|1bmfA2|2e-14|45.1|71/71|b.49.1.1 :============================================================:BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515 61: . . . * . .: 120 :TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG:Sequence :==================================== :RP:SCP|26->96|1bmfA2|2e-14|45.1|71/71|b.49.1.1 : ========================:RP:SCP|97->379|1bmfD3|9e-78|26.1|268/276|c.37.1.11 :============================================================:BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515 121: . . + . . .: 180 :GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV:Sequence :============================================================:RP:SCP|97->379|1bmfD3|9e-78|26.1|268/276|c.37.1.11 :============================================================:BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|150->377|PF00006|1e-26|34.0|212/212|ATP-synt_ab 181: . * . . . .: 240 :AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVAASASESAALQFIA:Sequence : XXXXXXXXX :SEG|227->235|aasasesaa :============================================================:RP:SCP|97->379|1bmfD3|9e-78|26.1|268/276|c.37.1.11 :============================================================:BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|150->377|PF00006|1e-26|34.0|212/212|ATP-synt_ab 241: + . . . . *: 300 :PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL:Sequence :============================================================:RP:SCP|97->379|1bmfD3|9e-78|26.1|268/276|c.37.1.11 :============================================================:BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|150->377|PF00006|1e-26|34.0|212/212|ATP-synt_ab 301: . . . . + .: 360 :ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD:Sequence :============================================================:RP:SCP|97->379|1bmfD3|9e-78|26.1|268/276|c.37.1.11 :============================================================:BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|150->377|PF00006|1e-26|34.0|212/212|ATP-synt_ab 361: . . . * . .: 420 :LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR:Sequence : ########## :PROS|368->377|PS00152|ATPASE_ALPHA_BETA|PDOC00137| :=================== :RP:SCP|97->379|1bmfD3|9e-78|26.1|268/276|c.37.1.11 : ====================================:RP:SCP|385->512|1bmfA1|9e-38|46.1|128/131|a.69.1.1 :============================================================:BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515 :$$$$$$$$$$$$$$$$$ :RP:PFM|150->377|PF00006|1e-26|34.0|212/212|ATP-synt_ab : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|389->440|PF00306|7e-06|38.5|52/106|ATP-synt_ab_C 421: . . + . . .: 480 :KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS:Sequence :============================================================:RP:SCP|385->512|1bmfA1|9e-38|46.1|128/131|a.69.1.1 :============================================================:BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|389->440|PF00306|7e-06|38.5|52/106|ATP-synt_ab_C 481: . * . . . .: 540 :HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW :Sequence :================================ :RP:SCP|385->512|1bmfA1|9e-38|46.1|128/131|a.69.1.1 :=================================== :BL:SWS|1->515|ATPA_NITOC|0.0|100.0|515/515