[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA59517.1 noce0 ABA59517.1 "ATP synthase F1, alpha subunit"
MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN
TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG
GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV
AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVAASASESAALQFIA
PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL
ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD
LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR
KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS
HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW
//