[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA59518.1"

            "H+-transporting two-sector ATPase, delta (OSCP) subunit"
ATPD_NITOC  "RecName: Full=ATP synthase subunit delta;AltName: Full=ATP synthase F(1) sector subunit delta;AltName: Full=F-type ATPase subunit delta;         Short=F-ATPase subunit delta;"

OrgPattern -------------------------------------------------------------------- -11--111111--1-----------------------------------------1-------------------------11---11-----1------1-111--111---------------11111111111---1-111-1-11111111111111-1111111111-11111-1111--------11111111111111111111111111111111-111111111111111111111111111----1-1--11-11111--1-1111-------------------------------------1---------111-1----------11111111--1--11-11111111--11--1---11-1111111-11111111111111111111111111-11111111111-1111111111111111-1111111111111111111--1-1--11-11-----1---11-------------1111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11--1111-1111111-211111111-------------------------11111-111111111111111111111111111-1111111-11111111111111111-11-1111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111112121111111111111111111-----------------------------1--------------1-11-1------ ------------11111--1111111-1111-1111111111111111111111--111111--1-11-1-111-------1111111----11-11111----12-1--2-3111-1-1--1-1111-131-111-1--1-11-111--1-1211111111-1---1-1112--111-----114------1-1--1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAEKITIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILIDDPRYTSEQLIG:Sequence :ccccHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHTcHHHHHHHTccccHHHHHHH:Sec Str : ===========================================================:RP:SCP|2->107|1abvA|2e-21|32.4|105/105|a.70.1.1 :============================================================:BL:SWS|1->178|ATPD_NITOC|5e-95|100.0|178/178 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->176|PF00213|7e-27|42.4|170/171|OSCP 61: . . . * . .: 120 :LFVEIGGDTVTESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIISAKPLAE:Sequence :HHHHHHcccccHHHHHHHHHHHHTTcGGGHHHHHHHHHHHHHHHHHcccccc :Sec Str :=============================================== :RP:SCP|2->107|1abvA|2e-21|32.4|105/105|a.70.1.1 :============================================================:BL:SWS|1->178|ATPD_NITOC|5e-95|100.0|178/178 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->176|PF00213|7e-27|42.4|170/171|OSCP 121: . . + . . .: 180 :EQLNEIASALKRRLGREVTFSRKTDESLLGGVIIRAGDLVIDGSAIGKLNQLAASLLH :Sequence : :Sec Str : #################### :PROS|138->157|PS00389|ATPASE_DELTA|PDOC00327| :========================================================== :BL:SWS|1->178|ATPD_NITOC|5e-95|100.0|178/178 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->176|PF00213|7e-27|42.4|170/171|OSCP