[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA57005.1 noce0 ABA57005.1 "Protein of unknown function DUF1328"
MFGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLLGRRGRPPL
//