[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL62507.1"

            "binding protein, putative"
            ""

OrgPattern ---1-1----------1-11-11-1-----21--1--1------11211---1------1-------- ---------------------------------------------------------------------------------1-------------------------------------------------------------------------------------1------------------11---------------------------------------------------------------------------------------------------------------------------------------111--1111111-1--------------2--11---121-21111-12---1------------2----1-----------------111111111-------------1------1------111-------------2--------------------------------------1111------------------------11111111112-11-1111-111----------------11--1111112121222-111-11113------22-1---11111-----------1-----11---------11111-1211111111111----1-----------------------------------------------------------------------------------------------------------1-------------------------------------------------------11111111111111------------------------------------------------------------------1------ --------------------111--------------------------1---1---11-------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKIGYLIIIIVAIVAVAALLAIPRPQAPMTQTPMAQASTSTTTPQKIVLYMATTTSVKD:Sequence : ccTTcEEEEEEGGGTTHH:Sec Str : XXXXXXXXXXXXXXXXX :SEG|7->23|liiiivaivavaallai : ==============:RP:SCP|47->269|1atgA|5e-11|15.5|207/231|c.94.1.1 61: . . . * . .: 120 :TGLLDVLIPDFEKWAASRGYNIEVRYTAVGTGQALAMAARGDVDVVIVHAPSLEKQYLEN:Sequence :HHHHHHHHHHHHHccEEcHHcccEEEEEEcHHHHHHHHHTTcccEEEccccHHHHHHHHT:Sec Str :============================================================:RP:SCP|47->269|1atgA|5e-11|15.5|207/231|c.94.1.1 121: . . + . . .: 180 :GTLKCRDVIAYNFFIIVGPRDDPAGAKSLTATEAFRRIAEAKAPFVSRGDRSGTHLMELS:Sequence :TcccTcEEEEEccEEEEEccTTTccTTGGGGccccccEEEEcTTTcHHHHHHHHHHHHTT:Sec Str :============================================================:RP:SCP|47->269|1atgA|5e-11|15.5|207/231|c.94.1.1 181: . * . . . .: 240 :LWRRAIGREPDPKNDTWYISAGAGMGQTLLLANEKSAYTLSDTGTWLRYRDKLPQLDVIV:Sequence :cHHHHHccTTHTTcEEEEccHHHHHHHHHHHHTTcccEEEEEGGGTccTTcccccEEEcc:Sec Str :============================================================:RP:SCP|47->269|1atgA|5e-11|15.5|207/231|c.94.1.1 241: + . . . . *: 300 :QAAPDLINIYSFSIVKLSNATRLMAQYMKTRGLEVIGNLTINGVSLFTPINKADPKAMEW:Sequence :cGGGccccEEEEEEcTTcccHHHHHHHHHcHHHHHcccEEcccccccTTccccGGGGccc:Sec Str :============================= :RP:SCP|47->269|1atgA|5e-11|15.5|207/231|c.94.1.1 301: . . . . + .: 360 :IKTAIFGPSCVER :Sequence :ccccccH :Sec Str