[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL62507.1 paer1 AAL62507.1 "binding protein, putative"
MSKIGYLIIIIVAIVAVAALLAIPRPQAPMTQTPMAQASTSTTTPQKIVLYMATTTSVKD
TGLLDVLIPDFEKWAASRGYNIEVRYTAVGTGQALAMAARGDVDVVIVHAPSLEKQYLEN
GTLKCRDVIAYNFFIIVGPRDDPAGAKSLTATEAFRRIAEAKAPFVSRGDRSGTHLMELS
LWRRAIGREPDPKNDTWYISAGAGMGQTLLLANEKSAYTLSDTGTWLRYRDKLPQLDVIV
QAAPDLINIYSFSIVKLSNATRLMAQYMKTRGLEVIGNLTINGVSLFTPINKADPKAMEW
IKTAIFGPSCVER
//