[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL62705.1 paer1 AAL62705.1 "hypothetical protein"
MVKKLNSVVRETRPTVVEFKLANFGKVTAKVVPMDVTVYEVGHGYRVDVAGKVEVEPERR
LYKAYLCSPNTQMVPVEFINTNYGYLSVELESLRLEVYIEIRVYASETSSDVDGAPCVNV
VWTHGIRMQLQR
//