[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL62792.1"

            "glycosyltransferase (type 2)"
            ""

OrgPattern 111111--222212111221131433323422225112233114317533336343434422112-12 22A-8111111---11211-11--2111111342222145245211---21--12-1111323-2-2342111111121-2-21111-------111--11--3333321---------------1213132232177755-118414212231211111-1-21-11211-1-----1----1----1--11-----------------1-------111--1--11---1----------------------------1--------------------------11-------------------------11---111----31-----------------1--1---1-11---21-2-111111---1-4------------22----11-------------------1---1--1--1211222-11------------1---------2---1111------------------------------1-1-2-------------------3--------------1------1---1-1-----------------111-1-13-11--1-31---144324341223232326-----------------------1---------------------------------------1-----------------------------------------------------------------------------1---------------2212211111-1---------------------------1---------------------------1-----------1---1--------1111--31552222-----------------------------------------------2- 11--11--1-----111111111111-111111111111111111111111111-11-1111111----1----1------1112111---11111111112-11112--211--1-----11-11-1-121-111------112-1---1--2---11-211111-111-11-1-1---1---1--1-1--111111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MCITVVLPTLNEAQALPKVVEELRATGYRDILVVDGGSTDGTVEEAKRLGLRVIGQYGRG:Sequence :ccEEEEEEcccccHHHHHHHHHHHHHcTTcEEEEEEccccHHHHHHHHHHHHHHHHHHHH:Sec Str : ========================================================:RP:SCP|5->197|2bo4A1|1e-20|18.7|193/380|c.68.1.18 : ==========================================================:BL:SWS|3->191|Y553_MYCBO|2e-22|38.2|186/218 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->108|PF00535|7e-12|42.9|105/148|Glycos_transf_2 61: . . . * . .: 120 :KGMALRTALMYVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARQGKMPALYKLGN:Sequence :HHHHHHHHHHHccccEEEEccTTccccHHHHHHHHHHHHTccEEEEEccTccHHHHHTHH:Sec Str :============================================================:RP:SCP|5->197|2bo4A1|1e-20|18.7|193/380|c.68.1.18 :============================================================:BL:SWS|3->191|Y553_MYCBO|2e-22|38.2|186/218 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->108|PF00535|7e-12|42.9|105/148|Glycos_transf_2 121: . . + . . .: 180 :KVLAWLFRVLFGVDLRDPLTGMYVARTDVLREAVTEARGFDLEVEILAKALANGARVAEV:Sequence :HHHHHHcTTccGGGcccTTcccEEEEHHHHHHHHHTcccTTHHHHHHHHHHHTTccEEEE:Sec Str :============================================================:RP:SCP|5->197|2bo4A1|1e-20|18.7|193/380|c.68.1.18 :============================================================:BL:SWS|3->191|Y553_MYCBO|2e-22|38.2|186/218 181: . * . . . .: 240 :PIQYRERIGKKKLRPWHGVGIAVKALELAYRLNPALFLTLIGALMLIPAVALGGWVAYRY:Sequence :EcTTcccEEEcTTccEHHHHHHHHHHHHHTTccccTTcccEEEEEccccccccccccHHH:Sec Str :================= :RP:SCP|5->197|2bo4A1|1e-20|18.7|193/380|c.68.1.18 :=========== :BL:SWS|3->191|Y553_MYCBO|2e-22|38.2|186/218 241: + . . . . *: 300 :FYQGVPHYMLGLAALLMLVIGGISTALLPLHTTIQQLRASIRRALIPPAPTDCLSPLPQP:Sequence :HHHTTccccHHHHHHGGGccHHHHHHH :Sec Str : XXXXX:SEG|296->311|plpqppppappqrpap 301: . . . . + .: 360 :PPPAPPQRPAPEKATVLERAAQGLITAFIVLLAAAAYYLGIGDAATANKLAEWAYYALAG:Sequence : :Sec Str :XXXXXXXXXXX :SEG|296->311|plpqppppappqrpap : XXXXXXXXXXXXXXXXXXXXXX :SEG|324->345|litafivllaaaayylgigdaa 361: . . . * . .: 420 :GVLATLIDTAIAQRRQKQLQRQAFRTSHSAVITS :Sequence : :Sec Str : XXXXXXXXXX :SEG|373->382|qrrqkqlqrq