[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL62997.1"

            "RNA binding protein (fmu, PCNA P120 homolog), probable"
            ""

OrgPattern 2213253422222224112222231--1-1-1---1--1-111-----1----84444444---12-- -----------------------------------------------------------------1-----------------------------------------------------------1-111----11--------1-1111111--11-1--1-111-11111-11111-1111-----11-12111111111111111111111111122211--1-----111111111111111111--111122122-1-122111111111-11122211111111111111111111111111111112121112221111111111111111111111111121-212-111121111112121-1-1------11111--1111111-11-11111111111--------11-11------1---111111-11-----1-1--------------1--------------------------------1-11------------------------------11-11--1-------------------1----------11-1--------------11-11111111--3-11---------------------------------------21-1---12111--1-1-----------------1--1------------------------------2121-1-1-1--------------1-------1-1---------------1111111111---1---------------11-1111---11-111-1---------1----------1121111121---------------------1--------------------------1-------------------111-111--- 111121212111112111-11111111111111111111111111111111111111111112111111111111-111111111111-1111111111-1-111112116232241111214-421324E3-337211-2-233-1-1-22-31432221124321311-13321111811-1111121311222221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNLYGIEIDDLLYKHFLEFLSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSR:Sequence : cEEEEEEccHHHHHHHHHHHHHTTccEEEEEccccccccccHHHHTTcc:Sec Str : ===================================================:RP:SCP|10->85|1ixkA|1e-10|31.6|73/305|c.66.1.38 : ========================================:BL:SWS|21->378|NSUN6_HUMAN|8e-26|31.3|351/469 61: . . . * . .: 120 :GLAVYRDEYIDDALWVPVEGPFKIPTAKKVVVVDKKAAESVMLGADLYAPAVIKTDRVNI:Sequence :TTEEEEcTTccEEEEEEEEccccTTc HHHHTTccEGGGEEEEETTccT:Sec Str : XXXXXXXXXXXX :SEG|87->98|akkvvvvdkkaa :========================= :RP:SCP|10->85|1ixkA|1e-10|31.6|73/305|c.66.1.38 : ======================:RP:SCP|99->160|1sqwA1|2e-10|14.5|62/76|b.122.1.1 :============================================================:BL:SWS|21->378|NSUN6_HUMAN|8e-26|31.3|351/469 : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->158|PF01472|9e-06|33.3|60/74|PUA 121: . . + . . .: 180 :GDEVNIVSDNGRVVALGVAVMDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYS:Sequence :TcEEEEEETTcEcccccccHTccccTTEEEEccccTTEEEEHHHcEEEEEEETTTEEEEE:Sec Str :======================================== :RP:SCP|99->160|1sqwA1|2e-10|14.5|62/76|b.122.1.1 : =====================================:RP:SCP|144->373|1ixkA|1e-38|31.5|219/305|c.66.1.38 :============================================================:BL:SWS|21->378|NSUN6_HUMAN|8e-26|31.3|351/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|99->158|PF01472|9e-06|33.3|60/74|PUA : $$$$$$$$$$$$:RP:PFM|169->372|PF01189|3e-21|40.7|194/229|Nol1_Nop2_Fmu 181: . * . . . .: 240 :QSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAAR:Sequence :ETTEEEEETTcHHHHHHHTTEETTcTTTHHHHHHHHTTcEEEEEEccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|144->373|1ixkA|1e-38|31.5|219/305|c.66.1.38 :============================================================:BL:SWS|21->378|NSUN6_HUMAN|8e-26|31.3|351/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->372|PF01189|3e-21|40.7|194/229|Nol1_Nop2_Fmu 241: + . . . . *: 300 :LGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQ:Sequence :TTcGGGEEEEccHHHHHHHHHTTccEEEEEEcccccccccccccHccccGGGHHHHHHHH:Sec Str :============================================================:RP:SCP|144->373|1ixkA|1e-38|31.5|219/305|c.66.1.38 :============================================================:BL:SWS|21->378|NSUN6_HUMAN|8e-26|31.3|351/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->372|PF01189|3e-21|40.7|194/229|Nol1_Nop2_Fmu 301: . . . . + .: 360 :IQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRFLPH:Sequence :HHHHHHHEEEEEEEEEEEccTTccHHHHHHHHHHHHTTEEEEccccccccTTccccTcGG:Sec Str :============================================================:RP:SCP|144->373|1ixkA|1e-38|31.5|219/305|c.66.1.38 :============================================================:BL:SWS|21->378|NSUN6_HUMAN|8e-26|31.3|351/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->372|PF01189|3e-21|40.7|194/229|Nol1_Nop2_Fmu 361: . . . * . .: 420 :VHNTPGFFIAVLRGARKEP :Sequence :GcccEEEEEEEEEEEEcEE :Sec Str :============= :RP:SCP|144->373|1ixkA|1e-38|31.5|219/305|c.66.1.38 :================== :BL:SWS|21->378|NSUN6_HUMAN|8e-26|31.3|351/469 :$$$$$$$$$$$$ :RP:PFM|169->372|PF01189|3e-21|40.7|194/229|Nol1_Nop2_Fmu