[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL62997.1 paer1 AAL62997.1 "RNA binding protein (fmu, PCNA P120 homolog), probable"
MNLYGIEIDDLLYKHFLEFLSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSR
GLAVYRDEYIDDALWVPVEGPFKIPTAKKVVVVDKKAAESVMLGADLYAPAVIKTDRVNI
GDEVNIVSDNGRVVALGVAVMDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYS
QSLPAILVGHIARRITQTDAVDLNSAPGGKTTHLAQMGIRVIAVDRSAQKIEKLRSEAAR
LGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGVRPKIYHKVTFEAAKTLARYQ
IQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWGCRECRRFLPH
VHNTPGFFIAVLRGARKEP
//