[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63125.1"

            "conserved hypothetical protein"
            ""

OrgPattern --1-1--111111111-11111-111111111111222222221111111111211111111111-11 ---------------------------------------------------------1--------------------11-1-11111------11-------------1-------------------------------111----------------------1-------------------------11111111111111111-11111111112---111111111111111111111111111111----------------------1111111---111-----------11111111111111--111---111221222222222212112222-2213---21111112-11-111111--11------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------1-----1---11-------------122212222121112333332323------221-----------1-------1111---111--------111-1--11111111-111--------------11111-1111111111-111111111111111111111111--1111111111111111111111111--111111111111-------------------------------------------------------------------------1111111111111----------------------------------1-------------------------2112122222--- 1111111-52211111111111111111111111111111111111111111111112111111111111111111111111111111-111111111111211121121211111-1111111111112C1-21211111-1311111-1111121211222211111131131111181111111121171132221 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASGVHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIK:Sequence : EEEEccccccccccccccTTcEEEccccccGGGHHHHHTTcEEEEEEEETTEEEEE:Sec Str : ==========================================================:BL:SWS|3->457|Y1136_METJA|e-115|50.3|447/541 61: . . . * . .: 120 :VYIENGHTPSKIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQ:Sequence :EccHHHHHHHHHHHHHTTcEEccccGGGHHHHHHHHHHHHHHHHHHHEccHccTHHHHHH:Sec Str : ===========================================:RP:SCP|78->258|1iwmA|4e-20|13.6|162/177|b.125.1.2 :============================================================:BL:SWS|3->457|Y1136_METJA|e-115|50.3|447/541 121: . . + . . .: 180 :IRNETAELRMVALTVETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAA:Sequence :HHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHTcH:Sec Str :============================================================:RP:SCP|78->258|1iwmA|4e-20|13.6|162/177|b.125.1.2 :============================================================:BL:SWS|3->457|Y1136_METJA|e-115|50.3|447/541 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|121->213|PF04055|2e-13|35.5|93/164|Radical_SAM 181: . * . . . .: 240 :EVVEATAILKDSAYKVCYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPN:Sequence :HEHHHHHHcccTcccccGGGcEEGGGEEEcccEEEEcccccHHHHTTTTEccEEEEEEET:Sec Str :============================================================:RP:SCP|78->258|1iwmA|4e-20|13.6|162/177|b.125.1.2 :============================================================:BL:SWS|3->457|Y1136_METJA|e-115|50.3|447/541 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|121->213|PF04055|2e-13|35.5|93/164|Radical_SAM 241: + . . . . *: 300 :TELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPRWGNMRQ:Sequence :TTccEEEEEEccEEcccTTcccHHHHHHTTccTTccEEcETcHHHHHHHHHHHHHHccTT:Sec Str :================== :RP:SCP|78->258|1iwmA|4e-20|13.6|162/177|b.125.1.2 :============================================================:BL:SWS|3->457|Y1136_METJA|e-115|50.3|447/541 301: . . . . + .: 360 :IVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLEIFLEAVGPDD:Sequence :TTcEEEEEEEETTEEEEEEEEcHHHHTHHHHHHcTTcccccTTcTTEEEEEEEETTTccE:Sec Str :============================================================:BL:SWS|3->457|Y1136_METJA|e-115|50.3|447/541 361: . . . * . .: 420 :TLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEI:Sequence :EEEEEEEEEcccccccEEEEEEEEcEEEEEEEEEE cGGGccccHHHHHHHHHHHH:Sec Str : ================:RP:SCP|405->458|1y9wA1|6e-09|35.2|54/140|d.108.1.1 :============================================================:BL:SWS|3->457|Y1136_METJA|e-115|50.3|447/541 421: . . + . . .: 480 :AGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLGVADDGLVAG :Sequence :HHHcTTEEEEEEccHHHHHHHHHHHHHHHHHTTHHHHTTcccccTTcEE :Sec Str :====================================== :RP:SCP|405->458|1y9wA1|6e-09|35.2|54/140|d.108.1.1 :===================================== :BL:SWS|3->457|Y1136_METJA|e-115|50.3|447/541