[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL63125.1 paer1 AAL63125.1 "conserved hypothetical protein"
MASGVHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIK
VYIENGHTPSKIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQ
IRNETAELRMVALTVETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAA
EVVEATAILKDSAYKVCYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPN
TELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPRWGNMRQ
IVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLEIFLEAVGPDD
TLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEI
AGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLGVADDGLVAG
//