[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63374.1"

            "glycolate oxidase subunit glcE"
            ""

OrgPattern 11---1221222221211232213-------1----------------12111-------12113--- --112-------1-21122-21113133333111111662-3211----1111211----111-133211---------1-1111111--------------1---------------------------------66633----22111111211111-11111111122-1-----1----11111---21122222222222222242111122223313--------2------------------------111-----11--11------------------------------------------------------3-11-----1-2-2-122111121-1-1--2-341111--32--1--1-2211--2111-1127443344444533333332334-22321323344-23333363335643---34222222232222222221122122-----------------------------2124-1222235334353333344563333224442443--22233433436434112211--211-1111222223-2511214221333-212112212222223131--111111111111111111111122----2------------------------1---3112-------------1---1-1111--111111111-1111111--1-----------------------------------------------1--111----21212---------------11111111322-22222322322232223------------------------112112111111111-1-111111----------1--------------------------11---1---3-1 ----332-32--2321332243343522222122222222-2212222333242212324441221332311113211222332231--1223131--1-1--221-121521142-1---22-42121383-2121--12--2111---2--21-1-33533231232331232211--1-1--3--421-1132322 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEM:Sequence :EccccHHHHHHHHHHHHHHTccEEEEcccccTTTTTTccccTTcEEEEcccEEEEETTTT:Sec Str : ===========================================================:RP:SCP|2->179|1mbbA1|1e-24|10.0|170/198|d.145.1.2 : ======================================================:BL:SWS|7->248|GLCE_ECOLI|4e-21|30.7|231/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->135|PF01565|1e-10|28.1|135/139|FAD_binding_4 61: . . . * . .: 120 :VVRTSACISAVELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLL:Sequence :EEEEcTTccHHHHHHHHHTTTGGGTEEccccccccccHHHHHHHTcccccTTccTGGGEE:Sec Str :============================================================:RP:SCP|2->179|1mbbA1|1e-24|10.0|170/198|d.145.1.2 :============================================================:BL:SWS|7->248|GLCE_ECOLI|4e-21|30.7|231/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->135|PF01565|1e-10|28.1|135/139|FAD_binding_4 121: . . + . . .: 180 :SVKIVTGKGEFMKFGAPVVKDVAGYNIKRLIAGSWGTLAVLVEAYMRIYALPESVAVMAT:Sequence :EEEEEcTTccEEEcGGccTTTcccccGGGGGGGccccccEEEEEEEEcEEccccEEEEEE:Sec Str :=========================================================== :RP:SCP|2->179|1mbbA1|1e-24|10.0|170/198|d.145.1.2 : =======================:RP:SCP|158->326|1f0xA1|2e-07|14.4|167/237|d.58.32.2 :============================================================:BL:SWS|7->248|GLCE_ECOLI|4e-21|30.7|231/350 :$$$$$$$$$$$$$$$ :RP:PFM|1->135|PF01565|1e-10|28.1|135/139|FAD_binding_4 181: . * . . . .: 240 :GRKSLQELRKLHVAGAAEADGVLYLRFEGVKSEVEYRLSKAGRGDVFYDREAEEKWSSVT:Sequence :EEccTTHHHHHHHHHHHHHHHTccccccEEEEEHHHHHHHHcccTTTccccccccHHHHH:Sec Str :============================================================:RP:SCP|158->326|1f0xA1|2e-07|14.4|167/237|d.58.32.2 :============================================================:BL:SWS|7->248|GLCE_ECOLI|4e-21|30.7|231/350 241: + . . . . *: 300 :EAEELFASNEIAKVVAPPASLPETPPGVKYLRYPLLGVMYVAGPPPAGVKAYWLKPQRKW:Sequence :HHHHHHTcccEEEEEEEEccHHHHHHHHHHHHHHGcTTcEEEcGGGcccccHHEcccccc:Sec Str :============================================================:RP:SCP|158->326|1f0xA1|2e-07|14.4|167/237|d.58.32.2 :======== :BL:SWS|7->248|GLCE_ECOLI|4e-21|30.7|231/350 301: . . . . + .: 360 :DVENRDLMEKIKRVLDPNGVLSPGRLP :Sequence :HHHHHHHHHHHHHcTTEEEEEEETGG :Sec Str :========================== :RP:SCP|158->326|1f0xA1|2e-07|14.4|167/237|d.58.32.2