[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL63374.1 paer1 AAL63374.1 "glycolate oxidase subunit glcE"
MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEM
VVRTSACISAVELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLL
SVKIVTGKGEFMKFGAPVVKDVAGYNIKRLIAGSWGTLAVLVEAYMRIYALPESVAVMAT
GRKSLQELRKLHVAGAAEADGVLYLRFEGVKSEVEYRLSKAGRGDVFYDREAEEKWSSVT
EAEELFASNEIAKVVAPPASLPETPPGVKYLRYPLLGVMYVAGPPPAGVKAYWLKPQRKW
DVENRDLMEKIKRVLDPNGVLSPGRLP
//