[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63439.1"

            "conserved hypothetical protein part 2, authentic frameshift"
            ""

OrgPattern -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGVFGTVIPYRLFSSAVTKIEGARASVIASVEPVLAALWGFLFFKEIPGLLTLTAYALIS:Sequence :============================================================:BL:SWS|1->69|Y1552_ARCFU|5e-07|31.9|69/270 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->66|PF00892|5e-04|34.8|66/125|EamA 61: . . . * . .: 120 :TAAVVVARK :Sequence :========= :BL:SWS|1->69|Y1552_ARCFU|5e-07|31.9|69/270 :$$$$$$ :RP:PFM|1->66|PF00892|5e-04|34.8|66/125|EamA