[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL63439.1 paer1 AAL63439.1 "conserved hypothetical protein part 2, authentic frameshift"
MGVFGTVIPYRLFSSAVTKIEGARASVIASVEPVLAALWGFLFFKEIPGLLTLTAYALIS
TAAVVVARK
//