[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63598.1"

            "paREP2a"
            ""

OrgPattern ------------------J------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAALKDWYRKCFRRPVVPGEEGKVVKRLELYYGMCEIAKAVMAEYGIKPDSPVIREYALR:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->98|PF07903|6e-20|62.7|75/101|PaRep2a 61: . . . * . .: 120 :RAFRREWRGKPISCFVTDLRASCNVGERRRHFACLTRPAAST :Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|23->98|PF07903|6e-20|62.7|75/101|PaRep2a