[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63603.1"

            "hypothetical protein"
            ""

OrgPattern ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKRKEEKRGPTLFDFIEVKKEEKKETPPQGVDISEELYAFIKSAKRVGKEEVVKWAKTR:Sequence : XXXXXXXXX :SEG|18->26|evkkeekke 61: . . . * . .: 120 :GVSAGDFYKALEKLLAQRRIRKKLDDEGNLVYEPG :Sequence