[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL63603.1 paer1 AAL63603.1 "hypothetical protein"
MAKRKEEKRGPTLFDFIEVKKEEKKETPPQGVDISEELYAFIKSAKRVGKEEVVKWAKTR
GVSAGDFYKALEKLLAQRRIRKKLDDEGNLVYEPG
//