[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63645.1"

            "paREP2b"
            ""

OrgPattern ------------------S6------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLFLPKYFHVLLPLAYAVEAYRRGELSREEAALAVIFAVLYDGTVFRDEILLFIGGPEHV:Sequence 61: . . . * . .: 120 :ESPIMTRDHFTAFWLWALKELGLKPSSVYRGRGAHHIAFKGAELNGLLEAVTPALPALHE:Sequence 121: . . + . . .: 180 :LRDALTEFADAFKVVTREAVKRKFGIDWGYDVRNEMFFKKLEEVVTMAEDYVYRNVTVER:Sequence : $$$$$$$$$$$$:RP:PFM|169->353|PF07775|5e-66|72.8|180/326|PaRep2b 181: . * . . . .: 240 :WPLDTSGKQPKAVIHFKLGGEEVAYITVYWTGRELQAQFGGSHENAERLASIIRALGGKA:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->353|PF07775|5e-66|72.8|180/326|PaRep2b 241: + . . . . *: 300 :EVKRIGKVWRTWLTTDDIIAIRHDGWLNAVRGFVDELYGKGLIDKDKYEQLVRDLETGPN:Sequence : ==============:BL:SWS|287->475|SECA_KOCRD|1e-04|30.9|175/927 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|169->353|PF07775|5e-66|72.8|180/326|PaRep2b 301: . . . . + .: 360 :TVKFAGVEFTVNYENKIMVKYHPRNENAKNAAVNALMARGLREGVHFTVTTEGTERYEIR:Sequence :============================================================:BL:SWS|287->475|SECA_KOCRD|1e-04|30.9|175/927 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|169->353|PF07775|5e-66|72.8|180/326|PaRep2b 361: . . . * . .: 420 :VTKEAFVKAIDALVHSGLEEGKHYSVYGKWRIISVKAEQKDVIVNALKAAGLKEGRDFTV:Sequence :============================================================:BL:SWS|287->475|SECA_KOCRD|1e-04|30.9|175/927 421: . . + . . .: 480 :KSSRYYVVYITYDGLREIQRMASNGDMEAEKFIRELEDVLRRRHGDGAAKKLTEVLRPAR:Sequence : ===================:RP:SCP|462->628|1g71A|8e-14|16.7|156/344|d.264.1.1 :======================================================= :BL:SWS|287->475|SECA_KOCRD|1e-04|30.9|175/927 481: . * . . . .: 540 :EEGTVDLPLAVYDDRGNLIARVVDLKCEFVKGKQRSKRLASQPVSQCAGEDCRLRIIVEY:Sequence :============================================================:RP:SCP|462->628|1g71A|8e-14|16.7|156/344|d.264.1.1 541: + . . . . *: 600 :ELPSGERRQFKMEWYWAEKREKKGDAIITYYYEIARPTVKDEVEAAVLETLTGKEAKRGR:Sequence :============================================================:RP:SCP|462->628|1g71A|8e-14|16.7|156/344|d.264.1.1 601: . . . . + .: 660 :VYLYADQLDALRRFKALKDAIDKWREGKPASSQGQGQRSDN :Sequence :============================ :RP:SCP|462->628|1g71A|8e-14|16.7|156/344|d.264.1.1