[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63679.1"

            "P. aerophilum family 66 protein"
            ""

OrgPattern ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFHDMAMWVLLGLLLAVLLIAKPEPLVVELEEGVGPVEWGVYLKTSEGLYKAAVVYLPAY:Sequence : XXXXXXXXXXX :SEG|9->19|vllglllavll : XXXXXXXXXXXXXXXXXXX :SEG|23->41|peplvveleegvgpvewgv 61: . . . * . .: 120 :YEVAFPDNTTGKAPFYQPWRFAVLPLERVNKTGNIVGRIITDQGTILFVDEPPVIIFAKE:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|85->176|PF09507|6e-04|30.3|89/412|CDC27 121: . . + . . .: 180 :ALASKPAKVMAKELPPPRSLAPKPKITTRNLENSESKDQAARPESTSVAVGAALEPVGAL:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|85->176|PF09507|6e-04|30.3|89/412|CDC27 181: . * . . . .: 240 :YLAGQARNNQYLRVYKADPYVSPPCGDDYVYLGKNVRHAALGILPRDWAQGRVVVELYNV:Sequence 241: + . . . . *: 300 :AGCSLIGTYSITVPPGGDYIFAYFILFSKFGGRDVSNTELAARFKFEGSGAISANVSIAY:Sequence 301: . . . . + .: 360 :NRVVAANFQTSTYDLRQYGTISSSQYFYGVLHAPHIPPDGLSDMNIDINVVLYTVDVANG:Sequence 361: . . . * . .: 420 :VCQYKQLKYEVYINNAYEGGGYLPCNTESSSCKCSGAITLSYSSAPFPLRSAKGAGRGAL:Sequence 421: . . + . . .: 480 :SVALIFKRPDSSTPPRIYLYTASQRISGNFWREIYTPYALSWEHLQQFALAHIINREATN:Sequence 481: . * . . . .: 540 :IAVVAKSTGTSMSGDWNLGLELGVGGPNIKRVDWINVRFRHNMAGRLSNIPYRLYYAMGD:Sequence 541: + . . . . *: 600 :AIKPVSAPWWQELGAAAADVISLVITIIPMGYSTSVLAGLLTYAAGKFINAATGQVVTYG:Sequence 601: . . . . + .: 660 :DNSTFYVEWWRGWSEPTPNYVVINLYMGYQGSDVNLNTEYITFASNRGIESYPAYSGGAV:Sequence 661: . . . * . .: 720 :PRYWGSIGETMTWWSFRGLAHYTTWNPR :Sequence