[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL63679.1 paer1 AAL63679.1 "P. aerophilum family 66 protein"
MFHDMAMWVLLGLLLAVLLIAKPEPLVVELEEGVGPVEWGVYLKTSEGLYKAAVVYLPAY
YEVAFPDNTTGKAPFYQPWRFAVLPLERVNKTGNIVGRIITDQGTILFVDEPPVIIFAKE
ALASKPAKVMAKELPPPRSLAPKPKITTRNLENSESKDQAARPESTSVAVGAALEPVGAL
YLAGQARNNQYLRVYKADPYVSPPCGDDYVYLGKNVRHAALGILPRDWAQGRVVVELYNV
AGCSLIGTYSITVPPGGDYIFAYFILFSKFGGRDVSNTELAARFKFEGSGAISANVSIAY
NRVVAANFQTSTYDLRQYGTISSSQYFYGVLHAPHIPPDGLSDMNIDINVVLYTVDVANG
VCQYKQLKYEVYINNAYEGGGYLPCNTESSSCKCSGAITLSYSSAPFPLRSAKGAGRGAL
SVALIFKRPDSSTPPRIYLYTASQRISGNFWREIYTPYALSWEHLQQFALAHIINREATN
IAVVAKSTGTSMSGDWNLGLELGVGGPNIKRVDWINVRFRHNMAGRLSNIPYRLYYAMGD
AIKPVSAPWWQELGAAAADVISLVITIIPMGYSTSVLAGLLTYAAGKFINAATGQVVTYG
DNSTFYVEWWRGWSEPTPNYVVINLYMGYQGSDVNLNTEYITFASNRGIESYPAYSGGAV
PRYWGSIGETMTWWSFRGLAHYTTWNPR
//