[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63787.1"

            "conserved protein with 2 CBS domains"
            ""

OrgPattern 3315-27576565639-2C7B9A3-------1--3551221112----1-224111211112113--3 -1--1-------11-11----1--11-----12---1---1121-1--------------221-111311---------------111-------------1---1--1----------------12-11-11122222-1-----312111321--------1---112--------------1-1111--3------111111-111--111-111121----------11-------------------------------------------------------------------------------------------11211111111-1-1---1-----1-----41---1-1211---------3-1112-----112222111221211-11111-11-12111111111-2--11121111222-112111111221--------1----12-------------------------------2---------4223231222233233333-11231211-----1-11111122--22-1-111-------122231----1-1--1--------------1151--------------------------------------1111------11----2--1-11----1----------------------------------------------------------------------------------------------------1-----1-1---------------1111111-----21321121311121111----------111-111112111111-1-11-------------1111-----------------------------------------1-111--- ----11--------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------4313-22--1111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIAS:Sequence :ccTTcccccccccEETTccHHHHHHHHHHccccEEEEccTTTccEEEEEEHHHHHHHHHH:Sec Str : =======================================================:RP:SCP|6->121|2yziA1|8e-24|32.2|115/132|d.37.1.1 : =======================================================:BL:SWS|6->119|YBP3_ACIAM|2e-17|39.3|112/164 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->122|PF00478|6e-06|27.2|103/459|IMPDH 61: . . . * . .: 120 :GIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKE:Sequence :HHHcccTTcccEEcccccccTTccHHHHHHHHHHHTccEEEEEETTEEEEEEEHHHHHHH:Sec Str :============================================================:RP:SCP|6->121|2yziA1|8e-24|32.2|115/132|d.37.1.1 :=========================================================== :BL:SWS|6->119|YBP3_ACIAM|2e-17|39.3|112/164 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->122|PF00478|6e-06|27.2|103/459|IMPDH 121: . . + . . .: 180 :SDVIERLVEYAEERIDEISAHD :Sequence :HHHHTTHHHHHHHHHHTHcccc :Sec Str := :RP:SCP|6->121|2yziA1|8e-24|32.2|115/132|d.37.1.1 :$$ :RP:PFM|12->122|PF00478|6e-06|27.2|103/459|IMPDH