[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL63787.1 paer1 AAL63787.1 "conserved protein with 2 CBS domains"
MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIAS
GIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKE
SDVIERLVEYAEERIDEISAHD
//