[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63893.1"

            "N-methylhydantoinase B (hyuB)"
            ""

OrgPattern 22-1-11232221231-111111-1--111-2----1------------11111------11-1---- -1--11-----------11-1----11-111-11111132--22---------11-------2-11-1-1------------31-1---------------------11---------------------1-1-1-11132----1111-1111111-1111111111111-1-----1--------------------------------331----11-1----------------------------------------------------------------------------------------------------------------------------------------11-----1-------1-11113-------322----111111111111112-1-4--4--452-41161232-342621-11351-111-2---------111--2-------------------------------119--243311-1111-----1112------318-411-----11111231-34-------------------3-1-1---1---11----------11------2-------------1-1111111---11----------1--------------------1---1211-------------------------------------------------------------------------------------------------------11------------------------1--2------1---111---------------------------------------------1-----------------------------------------------------1-- ----111-11--11122425121574422332211112221111112122226321111111132122111-61311-1121111111-12121114132211111-12121111121-1-11111111281-112111-11111-1-111--11--1123A12121111612111111C111111-53111112121- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRWELIYRATVYIAEEAGIALRNSAFSPNIRERMDHSVAVLNASGEIVAQAEHIPVHLGS:Sequence : EEcccEEEEEEEETTTTEEEEEEcccccHHH:Sec Str : =========================================================:BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B 61: . . . * . .: 120 :FYVGVKNLFNALREAGVELEEGDVVALNDPYISGTHLNDVMVVTPVFWRGRLVAYIVNKA:Sequence :HHHHHHHHHHHHTTTTccccccEEEEEEETTccccccccccccccEEETTEEEEEEEEEE:Sec Str :============================================================:BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B 121: . . + . . .: 180 :HHVDVGGPVPGSINPSAKTIYEEGFVLPPVKIIKRGEVNKEALSIWLSNVKTPEATIGDL:Sequence :ETTTccHHHHHHHHHHHHHHHTc :Sec Str :============================================================:BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B 181: . * . . . .: 240 :NAQIAANRVGTRRIVELFDKYGALVEEAWKRAIEYGRLMTQSEISKWPRGVYVAEDYLEL:Sequence : :Sec Str :============================================================:BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B 241: + . . . . *: 300 :GDKFLKIAVRLTIGECVEANYSGTDPQVDAPLNAVLGVTYAATSFPIRCLIRGDVPINEG:Sequence : :Sec Str :============================================================:BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B 301: . . . . + .: 360 :FYSCISVKAPEGSLLNPKRPAAVAGGNLETSQRTADAVFKALAEAMPDKVPAAGSGTMMN:Sequence : :Sec Str :============================================================:BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B 361: . . . * . .: 420 :VMMGGVYQGKYWSYYETIGGGTGGRPGKHGVSGVHVNMTNTLNTPIEIAERTYPLLFTAY:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|379->390|gggtggrpgkhg :============================================================:BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B 421: . . + . . .: 480 :RIREGSGGRGKWRGGDGIVRAFKVLAPTRLAILADRFKIGPWGIQGGEAGKPGRAYVKKA:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|423->437|regsggrgkwrggdg :============================================================:BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B 481: . * . . . .: 540 :GGRTIQLDSKTITDLEPGDEVVIETPGGGGWGPHNF :Sequence : :Sec Str :================================ :BL:SWS|4->512|Y963_METJA|e-134|49.1|503/563 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->512|PF02538|e-116|44.8|502/522|Hydantoinase_B