[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63897.1"

            "hypothetical protein"
            ""

OrgPattern ------------------11-11--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDVVVGRAYKVSLEALKRFPWGKYVKFAFLFGSASSGGPAGDLDIAISKISLEAFGDLLA:Sequence 61: . . . * . .: 120 :DLAKYLSPPRGLYRLSSSD :Sequence