[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL63897.1 paer1 AAL63897.1 "hypothetical protein"
MDVVVGRAYKVSLEALKRFPWGKYVKFAFLFGSASSGGPAGDLDIAISKISLEAFGDLLA
DLAKYLSPPRGLYRLSSSD
//