[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL63906.1"

            "P. aerophilum family 453"
            ""

OrgPattern ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDAYQLFREFYTSLGMPLRALIEFKARRAGRNPGEVFQKPWLFLRYVEEALGRHNAELIS:Sequence : HHHHHHHHHHHHTccGGGTccHHHHH HHHH HHHH:Sec Str 61: . . . * . .: 120 :TLFVEFVRRRRIYAQSAAEALWSEEGWRRFLQELGGV :Sequence :HHHTccccHHHHcccccccccccHHHHHHHHc :Sec Str