[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64120.1"

            "conserved hypothetical protein"
            ""

OrgPattern 111-11-1--------1-111111----------111------22-22--111123--212-1-1--- -------------1----------------------------1----1-12------1------2--------------------1--111--1-------------------------------11-111--1-1----1111--1112111----------1-111112-----------------111-11-------1--------------1--------------1---------------------------------------------------111--------------------------------------11-1111---------------1--------2-----1-2------------------------------------------------1-----1----------------------1--1------------------------------------------------------------1--1--1111111121111-1-1--22---11--------11--1----------------------111-11--2---1----212-11-----211-------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------1-1-11-----------------------------------------------------11-11-1-----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIRRGFLKFLFITPLGRLISGVLSAGIFSGVIFLDVIRTDVRKRTGADVEKVLLPYPRLR:Sequence : EEcccccccEEEccccccc:Sec Str 61: . . . * . .: 120 :GVVSVEEALANRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVY:Sequence :ccHHHHHHHHTcccccccccccccHHHHHHHHHHHTcEEETTTTEHTcccGGGcccEEEE:Sec Str : ========================================================:RP:SCP|65->274|1vfrA|1e-27|14.9|195/217|d.90.1.1 : ==========================================================:BL:SWS|63->255|Y1384_METJA|1e-34|46.9|179/198 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->252|PF00881|3e-15|40.4|156/157|Nitroreductase 121: . . + . . .: 180 :VVVGEHGVKTGDGYLKPGVYHYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIF:Sequence :EcccHHHHHHTTHccTTHHHHHHHccEEEEEEETEHHHHHHHHHTTccTHHHHccEEEEE:Sec Str :============================================================:RP:SCP|65->274|1vfrA|1e-27|14.9|195/217|d.90.1.1 :============================================================:BL:SWS|63->255|Y1384_METJA|1e-34|46.9|179/198 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->252|PF00881|3e-15|40.4|156/157|Nitroreductase 181: . * . . . .: 240 :TAVYSRTVRVYGERGRVRYVPMDLGHAGQNVYLQATALGLGTVAVGAFYDDQVAEILDLP:Sequence :EEEcHHHHHHcTTcccccHHHHHHHHHHHHHHHHHHHTTcEEEEEGGGGHHHHHHHTTcc:Sec Str : XXXXXXXXXXXXX :SEG|188->200|vrvygergrvryv :============================================================:RP:SCP|65->274|1vfrA|1e-27|14.9|195/217|d.90.1.1 :============================================================:BL:SWS|63->255|Y1384_METJA|1e-34|46.9|179/198 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->252|PF00881|3e-15|40.4|156/157|Nitroreductase 241: + . . . . *: 300 :DGETPLYIMPIGRPIYQYRLTEAELIRYIEKSRR :Sequence :TTEEEEEEEEEEcccccccccHHHHccccccccc :Sec Str :================================== :RP:SCP|65->274|1vfrA|1e-27|14.9|195/217|d.90.1.1 :=============== :BL:SWS|63->255|Y1384_METJA|1e-34|46.9|179/198 :$$$$$$$$$$$$ :RP:PFM|69->252|PF00881|3e-15|40.4|156/157|Nitroreductase