[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64265.1"

            "conserved hypothetical protein"
            ""

OrgPattern --1---14333444512322111-------------------------------91341132--5--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLFRDRPAERLEELFDREEEVRRLLNAVNSSALTLILGMRRVGKTSVVKAATYGKLRIYI:Sequence : EEEEEEcTTccHHHHHHHHHHHHHTEEE:Sec Str : XXXXXXXXXXXXXXXXX :SEG|9->25|erleelfdreeevrrll : ============================:RP:SCP|33->284|2fnaA2|7e-55|44.0|243/278|c.37.1.20 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->225|PF01637|6e-10|37.9|169/208|Arch_ATPase 61: . . . * . .: 120 :DARYFEEKRYISYGDLLEALRKELRRLLPLHKRLGELLSKIRGVSVAGVDVKFEIGRNAP:Sequence :EGGGGTTcccccHHHHHHHHHHHHHHHHHHcTTHHHHTTTcTTEHEEcccEEETccGccc:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|76->94|llealrkelrrllplhkrl :============================================================:RP:SCP|33->284|2fnaA2|7e-55|44.0|243/278|c.37.1.20 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->225|PF01637|6e-10|37.9|169/208|Arch_ATPase 121: . . + . . .: 180 :SFAEILEAFDQWAREQGERLVLIIDEAQELAKLRGRTLLPPLGYAYDNLRNISMVFTGSK:Sequence :cHHHHHHcTTTcEEcccTTEEEcccccEEETTcTTcccHHHHcccccccEEEEcccccTT:Sec Str :============================================================:RP:SCP|33->284|2fnaA2|7e-55|44.0|243/278|c.37.1.20 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->225|PF01637|6e-10|37.9|169/208|Arch_ATPase 181: . * . . . .: 240 :AGLLLRFLRLEDPHSPLFGRYFEKIELGPFSRELSVQFLTKGFEEAGVRVSRELIDRAVD:Sequence :cEEEEEEETTEEEEcccEEEETTEEEccccEEcccccTTcccEEEEEEcccccEEEEccc:Sec Str :============================================================:RP:SCP|33->284|2fnaA2|7e-55|44.0|243/278|c.37.1.20 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|31->225|PF01637|6e-10|37.9|169/208|Arch_ATPase 241: + . . . . *: 300 :ELDGVVGWLAYFGLRAVKKPDSALEETLEYAARLAAAEFCNFVQYMGSQRYIHVAKVCKN:Sequence :ccEEcHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHTTc:Sec Str :============================================ :RP:SCP|33->284|2fnaA2|7e-55|44.0|243/278|c.37.1.20 301: . . . . + .: 360 :GARWSEVKRYLQAVEGKPITDYEVTKLLKNLVDYGFLEKRGEIYLVPDPVLRTALQSLRC:Sequence :cccHHHHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEccccEEEccHHHHHHHT :Sec Str