[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL64265.1 paer1 AAL64265.1 "conserved hypothetical protein"
MLFRDRPAERLEELFDREEEVRRLLNAVNSSALTLILGMRRVGKTSVVKAATYGKLRIYI
DARYFEEKRYISYGDLLEALRKELRRLLPLHKRLGELLSKIRGVSVAGVDVKFEIGRNAP
SFAEILEAFDQWAREQGERLVLIIDEAQELAKLRGRTLLPPLGYAYDNLRNISMVFTGSK
AGLLLRFLRLEDPHSPLFGRYFEKIELGPFSRELSVQFLTKGFEEAGVRVSRELIDRAVD
ELDGVVGWLAYFGLRAVKKPDSALEETLEYAARLAAAEFCNFVQYMGSQRYIHVAKVCKN
GARWSEVKRYLQAVEGKPITDYEVTKLLKNLVDYGFLEKRGEIYLVPDPVLRTALQSLRC
//