[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64389.1"

            "conserved hypothetical protein"
            ""

OrgPattern 11----1111111111-111---122222122--1-------111-1111111--------111--11 11111---------11111-11--1111111111111111111111---11-1-11-1--11111111111-----------111122--------2-----1111211111111111111111111-111--11111111---11111111111--------1-111111------------11111---1-1-----------------1111-------11------------------------------------------------------------------------------------------------------111111111-1-11111----11--1--1-11-1--1111--------1----------11---111-----11111-11111---------111-------------11---------------------1---1111------------------------------------------------------------------1------1-----1------11------------111----111-1-1-1-111-11111111211111111--------------------1-122-------------------------------1---11-2--------------------------------------------------------------------------------------------1---------1-1-------------------------------------------------------1---1----------------------------111111----------------------------------------------12- ----11--------11111111111-1111111111111111111111111111111111111--------------------------12-1---111----11--1-122111111111111111313I1-3131111211111111-1--111121-----1121114311---1-----111--1111------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDARERCLSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMD:Sequence : HHHHHHHHHHHHHHccccccTTcccccccGGGHHHHHTTcccEEEEEEccccHHHHTTH:Sec Str : =====================================:RP:SCP|24->166|1j5sA|2e-10|9.0|134/451|c.1.9.8 : =====================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->131|PF03190|4e-26|39.8|108/126|DUF255 61: . . . * . .: 120 :ERTYNDEEVAEFINKHFIPVKVDRDERPDVDRRLQEAAQLISGQSGWPLTVFMTPKGQVI:Sequence :HHHHHHHHHHHTTccTTTTccEEEEEETTTccHHHHTTHTTcTcccccccEEEccccccc:Sec Str : XXXXXXXXXXXXXX :SEG|80->93|vkvdrderpdvdrr :============================================================:RP:SCP|24->166|1j5sA|2e-10|9.0|134/451|c.1.9.8 :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->131|PF03190|4e-26|39.8|108/126|DUF255 121: . . + . . .: 180 :WAATYLPPRREMGLPGMLEVLEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRRE:Sequence :ccEEccccccHHHHHHTTccccccccccccHHHHHHHccccccEEEEcccccHHHHHHHH:Sec Str :============================================== :RP:SCP|24->166|1j5sA|2e-10|9.0|134/451|c.1.9.8 :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 :$$$$$$$$$$$ :RP:PFM|24->131|PF03190|4e-26|39.8|108/126|DUF255 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|140->196|PF04905|2e-04|38.6|57/154|NCD2 181: . * . . . .: 240 :GQAEVLAALAASFDEEYGGFGGAPKFPPITQLELLMMRHFYDGVGIYGKMAERTLDAMAL:Sequence :HHHHTcTccccccccccTTTTTTTccTccccccccccccccccEEEEETHTTTEEEEEEE:Sec Str :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 :$$$$$$$$$$$$$$$$ :RP:PFM|140->196|PF04905|2e-04|38.6|57/154|NCD2 241: + . . . . *: 300 :GGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKALYKRTAEGIVK:Sequence :cTTccccEEEEEEETTTEEcccEEEcTTTTHHHHHHHHHHHHHTcccccEEEEETTEEEE:Sec Str : ================================:RP:SCP|269->560|1clcA1|1e-17|10.0|290/441|a.102.1.2 :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 301: . . . . + .: 360 :WLDEFMRAPEGGYYASQDADVDGEEGGYYRWSLEELKELLGELYPVASKHFGLEEYPWPE:Sequence :EccccTTccccTccccccccEEHHHHHHHHHHHHHHHHHcHHHHTcGGGGccccHHHHHH:Sec Str : XXXXXXXXXXX :SEG|333->343|leelkellgel :============================================================:RP:SCP|269->560|1clcA1|1e-17|10.0|290/441|a.102.1.2 :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 361: . . . * . .: 420 :GKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVYVGWSCAMAYAELLASRLASV:Sequence :HHHHHHHHTTccTTcccccEEcccccGGGcccccEEEEEcHHHHHHHHHHHHHHHHHHTT:Sec Str :============================================================:RP:SCP|269->560|1clcA1|1e-17|10.0|290/441|a.102.1.2 :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 421: . . + . . .: 480 :GNKYHAVRTLERFGVELGQRGRLPRGFRGGGPVGIAALEDYAYCILAWIEGYSHTAKLEF:Sequence :TcHHHHHHHHHHHHHHHHcccccccccTTcccccccccccHHHHHHHHHHHHHHHccHHH:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|437->454|lgqrgrlprgfrgggpvg :============================================================:RP:SCP|269->560|1clcA1|1e-17|10.0|290/441|a.102.1.2 :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 481: . * . . . .: 540 :LKVAESAGEILLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEV:Sequence :HHHHHHHHHTccccccccccTTccHHHHHHHccTTTTcccTTHHHHHHHTHHHHHHHHHH:Sec Str :============================================================:RP:SCP|269->560|1clcA1|1e-17|10.0|290/441|a.102.1.2 :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 541: + . . . . *: 600 :TGDAKYKEAAYRAVSALYGKMERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAALR:Sequence :cccHHHHHHHHHHHHHHHTTTcccc :Sec Str :==================== :RP:SCP|269->560|1clcA1|1e-17|10.0|290/441|a.102.1.2 :============================================================:BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 601: . . . . + .: 660 :AYRPWHVVVPITGNWPYKDPAVRAMLNGPKPAAYICAGGACSLPVREPERLEKTIEEFMK:Sequence : :Sec Str :======================================================= :BL:SWS|8->655|YYAL_BACSU|2e-76|31.7|637/689 661: . . . * . .: 720 :TKYALPL :Sequence : :Sec Str