[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL64389.1 paer1 AAL64389.1 "conserved hypothetical protein"
MDARERCLSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMD
ERTYNDEEVAEFINKHFIPVKVDRDERPDVDRRLQEAAQLISGQSGWPLTVFMTPKGQVI
WAATYLPPRREMGLPGMLEVLEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRRE
GQAEVLAALAASFDEEYGGFGGAPKFPPITQLELLMMRHFYDGVGIYGKMAERTLDAMAL
GGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKALYKRTAEGIVK
WLDEFMRAPEGGYYASQDADVDGEEGGYYRWSLEELKELLGELYPVASKHFGLEEYPWPE
GKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVYVGWSCAMAYAELLASRLASV
GNKYHAVRTLERFGVELGQRGRLPRGFRGGGPVGIAALEDYAYCILAWIEGYSHTAKLEF
LKVAESAGEILLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEV
TGDAKYKEAAYRAVSALYGKMERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAALR
AYRPWHVVVPITGNWPYKDPAVRAMLNGPKPAAYICAGGACSLPVREPERLEKTIEEFMK
TKYALPL
//