[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64489.1"

            "molybdopterin oxidoreductase, molybdopterin binding subunit"
            ""

OrgPattern 22-1-121434443422-2422344--311111-11-11222112-253--1-13223342-221--- 21322--------1121----4--23-----12333123321111-11----1-1-----1-1--23242---------6QF122212-------------------------------------113222122224332211-22---1---------------------------------21121---2-2---------------122212---112----------2-1111111111111111--111----------------------------------------------------------------------14-1----------13---222-----7--22YW2132-479---1----3--111-----246342-21723-11111111112-5535544442--2221-1211123331--221-3--415111111113---26-2-----------------------------1-121-122123336243344444365555345334543-355225133324564432332222----------853-AA81365435459-4648416137636-326243--1111-1---------291221131--122----33544148643473754B7----731------644124-6776641436-466555566656645666335523317656266766666964654224333--233343343433-------------2-111222312-212111-311111-1--12112112121223334322---------11224-11114412311-1111---------3-22------------------------------------------1-------11- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTNLSRREFGKLVVTTALVSSSVAALKPLFEAKSAQVTQTGVEAVPITCAACGAACGLFF:Sequence : HHH:Sec Str : XXXXXXXXXXXXXXX :SEG|12->26|lvvttalvsssvaal : XXXXXXXXX :SEG|49->57|caacgaacg 61: . . . * . .: 120 :VRNGQRMYLLPNPKHPQPGMCFRPASALQLWNHPLRLKKPLKRVGERGEGKFQEVDWETA:Sequence :EETTEEEEEEEcTTccccTTcTTHHHHHHHHHcTTcccccEEEHGGTTcccEEEccHHHH:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 121: . . + . . .: 180 :LNEIAQRLREIVQRYGPESVAFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRK:Sequence :HHHHHHHHHHHHHHHcGGGEEccccccccccccccHccEEEcccccTTHHHHHHHHTccc:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 181: . * . . . .: 240 :FVLGASGPSSVDPDYENANYILLIGRNLDAAMGHIRRLTVAREKGVKVVVVDPRAPNLAY:Sequence :cTTcccccHcHHHHHHHccEEEEEcccHHHHTTccHHHHHHHHHTcEEEEEccccHHHHH:Sec Str : XXXXXX :SEG|226->231|vkvvvv :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 241: + . . . . *: 300 :SSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTNAPFLIKPDGQPLTQKDLGQE:Sequence :HTcEEEcccTTcHHHHHHHHHHHHHHTTcccHHHHHHHEEcHHHHccccccccHHHEcHH:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 301: . . . . + .: 360 :GTAYLVYDNAAKSLAPHDKAQDPALDYEGEVQTPAGVIKVKTAFRLLAERAAKYTPENAE:Sequence :HHHHHHHHHTTTTccccHHTTTTccccHcHHHHHHHHHTTTTcccccHHHHHcccHHHHH:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 : $$$$$$$:RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 361: . . . * . .: 420 :KITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC:Sequence :HHHcccHHHHHHHHHHHHHccEEEEEccGGGccTTTHHHHHHHHHHHHHHTcTTcTTccT:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 421: . . + . . .: 480 :FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYP:Sequence :TcTTTTccccccccccccccccccEEEGGGGGHHHHHHcTTcEEEETEEEcTTEEEEccc:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 481: . * . . . .: 540 :VKALFIVATSPFHRDVNTEKLKKALQKLELIVAIDILPQDHIDWSDYVLPDLMFLEREEI:Sequence :ccEEEEEcccHHHHcccHHHHHHHGGGccEEEEEEccccHHHHTccEEEEcccGGGccEE:Sec Str : XXXXXXXXXXXX :SEG|499->510|eklkkalqklel :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 541: + . . . . *: 600 :GSIKWSLHAGIRYSHKVLDPPPGVDARSAFWALMEIIRRAFPEKAKIVEYDEKYADYNAF:Sequence :EEEcTTTccEEEEEcccccccTcTTcccHHHHHHHHHHHTTTcHHHHTTcHHHHHTTccH:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|96->285,354->576|PF00384|1e-29|43.7|397/423|Molybdopterin 601: . . . . + .: 660 :EHYEKKFFEAALRKLAETWKLDFEEIKEALERDGFYILKKKTYETRPYKTPLGTPSGKVE:Sequence :HHHHHHHHHHHHHHHTTcccccHHHHHHHcEccGGGccTTHHHHHcTTTcccccccccEE:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 661: . . . * . .: 720 :IYTLRALKYGIDPLPDWIPPVYKIPQASDEFYLVNGKDNFVSAHMVMVKNAKWIADRTVW:Sequence :cccHHHHHTTcccccccccccccTTcTTccccEEccccccTTcTTTcGGGTccTTccEEE:Sec Str :============================================================:RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================================:BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 : $$:RP:PFM|719->763|PF01568|2e-06|51.2|43/112|Molydop_binding 721: . . + . . .: 780 :MNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLFTYAFVGGRTSKLISGE:Sequence :EcHHHHHHTTccTTcEEEEEcccccEEEEEEEEEcTTccTTEEEcccTTTcccccccTTc:Sec Str :================================================ :RP:SCP|61->768|1h0hA2|2e-87|15.2|677/812|c.81.1.1 :============================================== :BL:SWS|61->766|PHSA_SALTY|3e-52|29.8|621/758 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|719->763|PF01568|2e-06|51.2|43/112|Molydop_binding 781: . * . . . .: 840 :YQFLKEGINPQWFTTGKVEPVVGSAPTNSSVRVRRL :Sequence :TTcccccccGGGcccccccTTTccccTTcEEEEEE :Sec Str