[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL64489.1 paer1 AAL64489.1 "molybdopterin oxidoreductase, molybdopterin binding subunit"
MTNLSRREFGKLVVTTALVSSSVAALKPLFEAKSAQVTQTGVEAVPITCAACGAACGLFF
VRNGQRMYLLPNPKHPQPGMCFRPASALQLWNHPLRLKKPLKRVGERGEGKFQEVDWETA
LNEIAQRLREIVQRYGPESVAFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRK
FVLGASGPSSVDPDYENANYILLIGRNLDAAMGHIRRLTVAREKGVKVVVVDPRAPNLAY
SSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTNAPFLIKPDGQPLTQKDLGQE
GTAYLVYDNAAKSLAPHDKAQDPALDYEGEVQTPAGVIKVKTAFRLLAERAAKYTPENAE
KITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC
FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYP
VKALFIVATSPFHRDVNTEKLKKALQKLELIVAIDILPQDHIDWSDYVLPDLMFLEREEI
GSIKWSLHAGIRYSHKVLDPPPGVDARSAFWALMEIIRRAFPEKAKIVEYDEKYADYNAF
EHYEKKFFEAALRKLAETWKLDFEEIKEALERDGFYILKKKTYETRPYKTPLGTPSGKVE
IYTLRALKYGIDPLPDWIPPVYKIPQASDEFYLVNGKDNFVSAHMVMVKNAKWIADRTVW
MNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLFTYAFVGGRTSKLISGE
YQFLKEGINPQWFTTGKVEPVVGSAPTNSSVRVRRL
//