[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64528.1"

            "ribosomal protein S10"
RS10_PYRAE  "RecName: Full=30S ribosomal protein S10P;"

OrgPattern 11111111111111111111111111111111111111111111111111111111111111111-11 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111-1----1---------1-----1-111111111111111-----1-----11111111-111111111111------111-1111------------1111111-11111111111111111111111111111111111111111111111111-11111-111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111--1-111111111111111111111---1-1111211111-1111111111111111111111---1--1--111--2-11111111111111-111111-----------1----1-1-----------------------------------1111111111111111111111111111111111111111111111111111111111-1-----111111111--1--------1---------11111--1---------------------------11111111111111111111111111-1111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-1-1-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------1111211---1-11111111111---1--------1-------1-11111111-1- 1111111152--1112111111111111111111111111111111111111111111-11111111111111111111111111111-121111-1111111214-111122111111311112315-252-112--1-3111211---1--11111111-121111112112--2218212325495142111-111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSG:Sequence :cTTcTTcccEEEEEEccHHHHHHHTTHHHHTTTTTcccEEEEEEcccEEEEEcccccccc:Sec Str : ################ :PROS|32->47|PS00361|RIBOSOMAL_S10|PDOC00312| : =====================================================:RP:SCP|8->104|1fjgJ|1e-21|39.6|96/98|d.58.15.1 :============================================================:BL:SWS|1->106|RS10_PYRAE|3e-56|100.0|106/106 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->105|PF00338|6e-10|39.6|96/97|Ribosomal_S10 61: . . . * . .: 120 :QGYHTFDHWEMRISKRLIDIEASERVLRRLMTIRVPDTVKIELQLI :Sequence :ccccccccEEEEEEEEEEEEcccHHHHHHHTTcccccccEEEEEc :Sec Str :============================================ :RP:SCP|8->104|1fjgJ|1e-21|39.6|96/98|d.58.15.1 :============================================== :BL:SWS|1->106|RS10_PYRAE|3e-56|100.0|106/106 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|9->105|PF00338|6e-10|39.6|96/97|Ribosomal_S10