[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL64528.1 paer1 AAL64528.1 "ribosomal protein S10"
MSLASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSG
QGYHTFDHWEMRISKRLIDIEASERVLRRLMTIRVPDTVKIELQLI
//