[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64590.1"

            "GTP cyclohydrolase II"
            ""

OrgPattern 11-1111111111111--111111111111111111111111112111111111-1-----1----11 1111-11111111-11111-1111111111111111----11------1111-1---11111-11-1---1----1-----12111111212-1-----1-11111-1111-------------1---1-111-11111-111111111111211111----11-1111111--1111-111111111---1111111111111111111111111111111111------1111111111111111111111--1----2---1111----111-111111-------11111111111-----------------------11-11111111111111111111-111--1111111-11211111-1-11-11------1--2111111111111-1111111111-11111111111-1221-112221111111111-1--11-111111111111111211111111-------------------11-13211211111222121111122--11111132112111111211---11111111111-1-1111111111111111211112112111-21231111111-11111111111111111111111111111122112111-1--11-----21----2-11-111-1111-------1--1--11111111111-111111111111111111111111--1-----------------111111111111111111111---111111111111---11111-111111111111111211111----1---211111111111111111----111111-----1111111111111111-1--1111------------------------------------11-111-1-1111 ------------11--1--111-1111------111-11111111-11--1111111-1111111111111-111-----11-11111-11111111----21111---------------------------------------------------------1-----------11118111--2113--2-11--1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGIEDAIAAFKAGRLVMIYDGDDREAEVDFVIRADAVTPTTIRWLRQNAGGLLCFVTTRE:Sequence : HHHHHHHHHTTccEEEEccTTTTccEEEEEEGGGccHHHHHHHHHHTccccEEEEcHH:Sec Str : ==========================================================:RP:SCP|3->209|1g57A|5e-36|29.7|182/205|d.115.1.2 : ==========================================================:BL:SWS|3->209|RIBB_METMA|4e-34|39.7|204/247 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->205|PF00926|5e-25|42.3|182/194|DHBP_synthase 61: . . . * . .: 120 :VGEILGLEFLSSYYKRRGFLATAPYGDEPAFMGYVNHVKTKTGIRDVDKALTIRELAKVV:Sequence :HHHHHTHHHHTTTcTHHTccccccccccccEEEEEEETTccccccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|3->209|1g57A|5e-36|29.7|182/205|d.115.1.2 :============================================================:BL:SWS|3->209|RIBB_METMA|4e-34|39.7|204/247 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->205|PF00926|5e-25|42.3|182/194|DHBP_synthase 121: . . + . . .: 180 :QLAQRDPEEAREAFKANFYMPGHVPILGGRLGERWGHTELSLILAKAAGVPPAVVIVEVL:Sequence :HcGG TTcGGGHHHHEEEEEEEEEETTGGGTcccHHHHHHHHHHHTTcccEEEEEEcc:Sec Str :============================================================:RP:SCP|3->209|1g57A|5e-36|29.7|182/205|d.115.1.2 :============================================================:BL:SWS|3->209|RIBB_METMA|4e-34|39.7|204/247 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->205|PF00926|5e-25|42.3|182/194|DHBP_synthase 181: . * . . . .: 240 :GDHTEAMPVEEAREYSKTLGVPLVTGTEIKSLI :Sequence :cTTcccccHHHHHHHHHTTTcEEEEHHHH :Sec Str :============================= :RP:SCP|3->209|1g57A|5e-36|29.7|182/205|d.115.1.2 :============================= :BL:SWS|3->209|RIBB_METMA|4e-34|39.7|204/247 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->205|PF00926|5e-25|42.3|182/194|DHBP_synthase