[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64645.1"

            "conserved hypothetical protein"
            ""

OrgPattern -----1-1----------111-------1------------------------------1-------- --1---------------------1-----------------------------------------------------------------1--1---------1----1-------------------------------1-------1-11-------------------------------1--------1---------1------------------1--1--------------------------------------------------------------------------------------------------------------------------------1------------11-----------2----------------------------------------1--11--1111111------12-1-----------------------------11---------------------33---------------------------------------------------------------------------------------------1-2-----11---------------------------------1--1-----------------------------------1-1---------------------------------1332--1--2-2-2112222121-2----------111111111111---111--1---------1111--1-------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDIWFVATVSAVLAAVTLSFKYRADIIAFVSLMALVLVGVYDLREALSYLISPAVIVLFG:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|6->19|vatvsavlaavtls : =====================================:BL:SWS|24->163|SAC1_CHLRE|2e-10|22.1|140/585 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->159|PF03600|2e-13|35.8|137/340|CitMHS 61: . . . * . .: 120 :SMVISGVIADSGLLDRVARYISVRVRHVATASLLLYFVAGVASGFVSDVAIVLAMAVLIG:Sequence : :Sec Str :============================================================:BL:SWS|24->163|SAC1_CHLRE|2e-10|22.1|140/585 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|23->159|PF03600|2e-13|35.8|137/340|CitMHS 121: . . + . . .: 180 :DVAKRLGASPAAYVIPLAFAAAIGGRLTMVGNAGNVILLDIYQTTTGEKLNILAFTAPAL:Sequence : :Sec Str : XXXXXXXX:SEG|173->194|laftapallalaisvpllllis :=========================================== :BL:SWS|24->163|SAC1_CHLRE|2e-10|22.1|140/585 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|23->159|PF03600|2e-13|35.8|137/340|CitMHS 181: . * . . . .: 240 :LALAISVPLLLLISFYAQRFVPQLSTAVKFLVVTTEVGETLDGKTRQEVEKAYRVKILTK:Sequence : :Sec Str :XXXXXXXXXXXXXX :SEG|173->194|laftapallalaisvpllllis 241: + . . . . *: 300 :DRILLKYSTVLVKIAVSDIPSFMTSKDLILRPLGNNKGEHMEFLIVTQRSRLVGKTLALE:Sequence : TTccccHHHHHHHHHcccEEEEEEccTTcTTTTccHHHH:Sec Str : ===========================================:RP:SCP|258->350|1lnqA4|4e-08|32.5|83/92|d.286.1.1 301: . . . . + .: 360 :PIHNVFPVSIIGIVPSGPVESLESYVFRPGDEILVLGDEKVIERIAAYYRLERSKTLVKA:Sequence :THHHHHccEEEEEEETTEEcccTTccccTTcEEEEEEcHHHHHHHHHHHT :Sec Str :================================================== :RP:SCP|258->350|1lnqA4|4e-08|32.5|83/92|d.286.1.1 : ======================================:BL:SWS|323->380|ROGDI_BOVIN|7e-04|41.8|55/287 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|315->411|PF00521|2e-04|25.0|96/434|DNA_topoisoIV 361: . . . * . .: 420 :FNPRLAASGISGLFAAVVLSQFAPASLAFIIGTFIALLGGGKAVERLYQYVSWETLIYVG:Sequence : :Sec Str :==================== :BL:SWS|323->380|ROGDI_BOVIN|7e-04|41.8|55/287 : ========================================================:BL:SWS|365->445|Y532_BUCBP|7e-04|32.1|81/403 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|315->411|PF00521|2e-04|25.0|96/434|DNA_topoisoIV 421: . . + . . .: 480 :SFLAIGTAAARIDLLKPITPLLNSPEYLFVIGLFLTNTLGLIPSAVLIGPYLTTKEMLMT:Sequence : :Sec Str :========================= :BL:SWS|365->445|Y532_BUCBP|7e-04|32.1|81/403 481: . * . . . .: 540 :YVLATIPILLPPAHPAIYLIYREYGLSIKDFLKISIPATAIAILATGIAVYLYYNLPIQT:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|483->500|latipillppahpaiyli : XXXXXXXXXXXXXXXX :SEG|514->529|isipataiailatgia 541: + . . . . *: 600 :PIFQLP :Sequence : :Sec Str