[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64825.1"

            "hypothetical protein"
            ""

OrgPattern -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFSKIKLGIEEWKKLEADLERISSGAPLELIINLTLVASGGEEEEEEEEHHHNHVHEIDN:Sequence : XXXXXXXXXXXXXXXX :SEG|42->57|eeeeeeeehhhnhvhe 61: . . . * . .: 120 :DFTREVAKLIDYIAHTYNAHVHPHVHANHGSVMFAVKGAPKDLLKALREVLDFVKLNCEK:Sequence : XXXXXXXXXXXX :SEG|78->89|nahvhphvhanh 121: . . + . . .: 180 :CLLHSLDGEFHLGEDLSGIYFGDSYKITVIVPAEDGKRLKVHEVHF :Sequence