[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64830.1"

            "hypothetical protein"
            ""

OrgPattern -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIERTGNPVSKLLQLLEEDLKRDDIIQIERVPAPKPSVKYREVVSKFLKEFGLATVYIR:Sequence 61: . . . * . .: 120 :IRSAAFERRYVISAKYDWTMGGVVEGWVVEGDVVRIFEPIAISLTDMEKALDYYGDAFWK:Sequence : XXXXXXXXXXXXXX :SEG|81->94|ggvvegwvvegdvv 121: . . + . . .: 180 :AEEKLLSKKMTEAYQEEKPPAD :Sequence