[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64884.1"

            "hypothetical protein"
            ""

OrgPattern ------------------11--1--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIRTGTVAFTSCKGGAGKTTLAVNVSAALPLNVLLIDLGGGASRFFPAPLINIENITPTI:Sequence : cccEEEEEEEcTTccHHHHHHHHHHHHHccEEEEcTTccccHHHHTccccccHHHHHH:Sec Str : ======================================================:RP:SCP|7->158|1cp2A|1e-09|16.0|150/269|c.37.1.10 : ======================================================:BL:SWS|7->163|SOJ_BACSU|1e-04|29.2|154/253 : $$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->29|PF07015|1e-04|69.6|23/197|VirC1 61: . . . * . .: 120 :EAYRDARVKNLFVIPIAIDPASVWRIENWEEIFQNLTDAVRKNIVKNSIDVVVLDMYQLS:Sequence :HHccTTcccHHHHcEEcGGGcEEEcccTTHHHHHHHHHHHHTTcccccccEEEEEccccc:Sec Str :============================================================:RP:SCP|7->158|1cp2A|1e-09|16.0|150/269|c.37.1.10 :============================================================:BL:SWS|7->163|SOJ_BACSU|1e-04|29.2|154/253 121: . . + . . .: 180 :RITPIETFGLDKADLIVLVVEGCEDCTKPITIIKKFFDGKLIIALNKHERGIEYPGAVVK:Sequence :cTTTTHHHHTTTccEEEEEccccHHHHHHHHHHHHHHcccccEEETTTTcccccHHHHHH:Sec Str :====================================== :RP:SCP|7->158|1cp2A|1e-09|16.0|150/269|c.37.1.10 :=========================================== :BL:SWS|7->163|SOJ_BACSU|1e-04|29.2|154/253 181: . * . . . .: 240 :IPFSATLDYYNRRGQFYTKPVTKLAEYLLQELKRVTRSRWIE :Sequence :HHHTcEEEEEEccc ccccHHHHHHHH :Sec Str