[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64909.1"

            "conserved hypothetical protein"
            ""

OrgPattern 11--11-1--------11111111-1111111111-------------1----11111111-----11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -1----1-1------11------1----------------------1111111111111111------------------------1-----1---------11-1--1-1321112-----1-21---191-111----1--11-----1--1-1111121-11-11-131111--------111112-11111111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFSIAIPHDFLSEIPDEAGKVRKLGYLARAAAIFKAEYIIIYHYGTPRREDIDFAKTVLE:Sequence : EEEEETTTTTTcccHHHHHHHHHHHHHHHHHTTccEEEEEc ccccHHHHHHH:Sec Str : ==========================================================:RP:SCP|3->112|1k3rA2|6e-11|33.3|108/191|c.116.1.2 : ==========================================================:BL:SWS|3->257|CI114_HUMAN|8e-22|35.5|251/376 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->257|PF02598|6e-31|40.3|248/289|DUF171 61: . . . * . .: 120 :YLVTPPYLRKKVYKIDNRLKLAGLLPPLKIPSHTVPVEPRIGEIREGIVERWDGYYSLIY:Sequence :HHHccHHHHHHHccccGGGTTGGGccccccTTcccc cccTTcEEEEEEEEEccccEEEE:Sec Str :==================================================== :RP:SCP|3->112|1k3rA2|6e-11|33.3|108/191|c.116.1.2 : ==============================:RP:SCP|91->143|1k3rA1|1e-06|25.0|52/71|b.40.4.10 :============================================================:BL:SWS|3->257|CI114_HUMAN|8e-22|35.5|251/376 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->257|PF02598|6e-31|40.3|248/289|DUF171 121: . . + . . .: 180 :IGGGKYAKVPKPYPIGTRLLVRIEGTTSRPDTYRAAVYRGAPPDYWGYKIDVRPLQNLSE:Sequence :ccccEEE EcccccccccEEEEEEEEEEcccccccccEEccc ccHHH:Sec Str :======================= :RP:SCP|91->143|1k3rA1|1e-06|25.0|52/71|b.40.4.10 : ======:RP:SCP|175->260|1k3rA2|1e-06|25.5|79/191|c.116.1.2 :============================================================:BL:SWS|3->257|CI114_HUMAN|8e-22|35.5|251/376 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->257|PF02598|6e-31|40.3|248/289|DUF171 181: . * . . . .: 240 :GFDTVILTGKEGKSICEAKPKIGKKTLVVFGGPRKGVDEIFREAGLEPPGELINFAPGQG:Sequence :cccEEEEEccccccTTHHHHHHccEEEEEccccccccccccccE EEcccTTcc:Sec Str :============================================================:RP:SCP|175->260|1k3rA2|1e-06|25.5|79/191|c.116.1.2 :============================================================:BL:SWS|3->257|CI114_HUMAN|8e-22|35.5|251/376 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->257|PF02598|6e-31|40.3|248/289|DUF171 241: + . . . . *: 300 :VETIRTEEAVFIVLSILNYIAKCSYKREAL :Sequence :cccccHHHHHHHHHHHHHHHcc :Sec Str :==================== :RP:SCP|175->260|1k3rA2|1e-06|25.5|79/191|c.116.1.2 :================= :BL:SWS|3->257|CI114_HUMAN|8e-22|35.5|251/376 :$$$$$$$$$$$$$$$$$ :RP:PFM|3->257|PF02598|6e-31|40.3|248/289|DUF171