[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64927.1"

            "pullulanase"
            ""

OrgPattern --4-3--1111111111123231-------------------------------11-311--1----- -11--------------------------------------------------------------------------------1--11----------------------------------------------------------111111111--------1111111----------------1133----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------2---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------111--1---------------1111111112212---------------------------1111----1-----------------------------111-------------------------------------------------------------------------------------------------------------------------------------1--------------------------1--------------------------------------------------------------------------11--1-----1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKWTFLLTLFVIFLAAEPINIIFIFHNHQPWYLDFSKNELALPWVRMHAVGNYLKVPLLI:Sequence : :Sec Str : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->82,174->476|PF03065|1e-33|35.2|326/349|Glyco_hydro_57 61: . . . * . .: 120 :NQSGVSVAFTLSGSLIEQLNWYSNGTYTDARFRISEKIARGEPLTIEEKYAMLAVPGGFF:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|24->82,174->476|PF03065|1e-33|35.2|326/349|Glyco_hydro_57 121: . . + . . .: 180 :DINWQNILNKHPRYAVLLGVRNDAFNKCPPGNMTCVVSRFSDQDFIDLATLFNLLWIDPY:Sequence : :Sec Str : =====:RP:SCP|176->356|1ufaA2|1e-21|23.3|176/404|c.6.2.4 : $$$$$$$:RP:PFM|24->82,174->476|PF03065|1e-33|35.2|326/349|Glyco_hydro_57 181: . * . . . .: 240 :IARQNPEIWALRNKTNYTREDLKKVLQIHLELIKQVLPVYKKLAEQGRIELVPVPYSHPL:Sequence : HHHHHHHHHHHHHTTccHHHHHHHHHHHHHTTcEEEEccccccc:Sec Str :============================================================:RP:SCP|176->356|1ufaA2|1e-21|23.3|176/404|c.6.2.4 : ====================:BL:SWS|221->398|AMY1_DICT6|7e-08|25.8|163/686 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->82,174->476|PF03065|1e-33|35.2|326/349|Glyco_hydro_57 241: + . . . . *: 300 :MPLLADMGAIYDLKLHVNLSNSLFKRYLGVTPTGVWPPEQAVNDEVLRLFANAGYIWTVT:Sequence :GGGccHcHHHHHHHHHHHHHHHHHHHHHcccccEEccGGGcccHHHHHTcccEEEcccEE:Sec Str :============================================================:RP:SCP|176->356|1ufaA2|1e-21|23.3|176/404|c.6.2.4 :============================================================:BL:SWS|221->398|AMY1_DICT6|7e-08|25.8|163/686 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->82,174->476|PF03065|1e-33|35.2|326/349|Glyco_hydro_57 301: . . . . + .: 360 :DEDVLKATAPGASHFKLYFVQYGDRKLYVFFRDKTLSDNIGFRYSSLSPEAALADFVNYL:Sequence :ccHHHHccHHHHHHHHHHHccTTEEEEEETTcHHHHccccGGGTccccHHHHHHHHHHHH:Sec Str :======================================================== :RP:SCP|176->356|1ufaA2|1e-21|23.3|176/404|c.6.2.4 :============================================================:BL:SWS|221->398|AMY1_DICT6|7e-08|25.8|163/686 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->82,174->476|PF03065|1e-33|35.2|326/349|Glyco_hydro_57 361: . . . * . .: 420 :KRVPREKCSVVVIALDGENPWENYPNFGDDFLRVFFQGLAQLEKNGTVKIWKPSDFIKAC:Sequence :HHTcc ccTTccccccccTTTHHHHHHHHHHHHHHHTTccccEEEEEEEEETcc:Sec Str :====================================== :BL:SWS|221->398|AMY1_DICT6|7e-08|25.8|163/686 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->82,174->476|PF03065|1e-33|35.2|326/349|Glyco_hydro_57 421: . . + . . .: 480 :GNEAAELPQREFKYFDLHLDLSFYKSIRDLPTRLVNGRIAEGSWSGGGSLAVWIGDPDEN:Sequence :ccHHHHHHHHHHHHHHHHHH HHHTTcccccEEEcccccccccTTccGGGTccHHHHHHH:Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|24->82,174->476|PF03065|1e-33|35.2|326/349|Glyco_hydro_57 481: . * . . . .: 540 :VWWMWLKKAREEVGVNRTWDVIFPLLIAEASDWPFWYGGDMGSPITFDPIAKSALITYYK:Sequence :HHHHHHHHHHHHHHcccGGGcHHHHHHHTcTTTTT :Sec Str 541: + . . . . *: 600 :RAGLEPPRYLLSPAYPAGTPREDKVAGRGDGRIRTYQGLTVHVNTTHIWAEGAPCGVLYI:Sequence : :Sec Str 601: . . . . + .: 660 :SNPDIPRSPYIFRGAVRGIYGESLNIIADMAIDTCSGVVYLSDGGVFYPVGRAASLSFIG:Sequence : :Sec Str 661: . . . * . .: 720 :ARPGGRLYLEFKGLVYIVNIPEAEVAQQLLLKAADPVGDDFGPGRYQYPKNPVFKPGVFD:Sequence : EcccccccTTTTccccccTTccTTTTc:Sec Str : ===========================:RP:SCP|694->913|1ug9A3|2e-59|30.4|214/245|b.1.9.3 : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|695->902|PF09985|2e-46|49.3|205/226|DUF2223 721: . . + . . .: 780 :LTEFSLYDVGDKLRFVFKVRELGDNPWGGPAGFSLQFFHVYINRGSGSRNDTLGLRVALC:Sequence :EEEEEEEEETTEEEEEEEEcccccccccccc cccEEEEEEEEccccccEEccGGcEEE :Sec Str :============================================================:RP:SCP|694->913|1ug9A3|2e-59|30.4|214/245|b.1.9.3 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|695->902|PF09985|2e-46|49.3|205/226|DUF2223 781: . * . . . .: 840 :RDAAWDVALLIGPGWSGGNRIVYSDNTYVDDAMSIKVAPNNTVVADVPKRYIGEFNSSWK:Sequence : ccccc EEEEEEccTTccEEEcTTccEEEccEEEEEGGGTEEEEEEEGGGccccccEEE:Sec Str :============================================================:RP:SCP|694->913|1ug9A3|2e-59|30.4|214/245|b.1.9.3 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|695->902|PF09985|2e-46|49.3|205/226|DUF2223 841: + . . . . *: 900 :ITVFLTSWDGYGPDNIRNFGVVSDEWTAGGADPVAVLANVAPRVFDLLAETAEQQIKALT:Sequence :EEEEEcccGGGcTTccc :Sec Str :============================================================:RP:SCP|694->913|1ug9A3|2e-59|30.4|214/245|b.1.9.3 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|695->902|PF09985|2e-46|49.3|205/226|DUF2223 901: . . . . + .: 960 :SYQVTRLPNGTYLGRPTRVCAYISGGKATETYTVTQTITITQTEVSTTTKTIATRETITS:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|929->961|tetytvtqtititqtevstttktiatretitst :============= :RP:SCP|694->913|1ug9A3|2e-59|30.4|214/245|b.1.9.3 :$$ :RP:PFM|695->902|PF09985|2e-46|49.3|205/226|DUF2223 961: . . . * . .:1020 :TYVTTATQVIKEADWTTASLIGILALTIGLVAGLLTRRR :Sequence : :Sec Str :X :SEG|929->961|tetytvtqtititqtevstttktiatretitst