[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "paer1:AAL64945.1"

            "indolepyruvate ferredoxin oxidoreductase beta subunit"
            ""

OrgPattern --3-12111111111111111111--------111---222221111112222-2222222-111--- -------------------------------------------------------------------------------122------1111-111------------------------------1-11--11-------111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2231-----------21------1-1---1-2---1121-2121-121---1------------------11111----------------------------------------------------------------1-1--------------------------------------------------------------------------------------1----------------1-1-23-11--111111-2221221111111--11---------------------11---------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATSLVIVGVGGQGVLTLARWIGEAALAEGYDVRIAEVHGMSQRGGSVEVHVRYGKDIYA:Sequence : XXXXXXXXXX :SEG|6->15|vivgvggqgv : ====================================:RP:SCP|25->170|1b0pA4|4e-04|15.8|146/253|c.64.1.1 : =============================================:BL:SWS|16->171|IORB_PYRAB|1e-25|42.9|156/202 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->181|PF01558|8e-13|39.4|160/178|POR 61: . . . * . .: 120 :PIVEEGGADYVIALEALEALRAYKYLKRGGELIVNRRVIQPPGNWLEEEEVFKAILTSGL:Sequence :============================================================:RP:SCP|25->170|1b0pA4|4e-04|15.8|146/253|c.64.1.1 :============================================================:BL:SWS|16->171|IORB_PYRAB|1e-25|42.9|156/202 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->181|PF01558|8e-13|39.4|160/178|POR 121: . . + . . .: 180 :KSYIVPCFDIAIELGSPLYENAVMLGFFSQLAGLPMPPSLDERNREAFRRGALVYNSLAP:Sequence :================================================== :RP:SCP|25->170|1b0pA4|4e-04|15.8|146/253|c.64.1.1 :=================================================== :BL:SWS|16->171|IORB_PYRAB|1e-25|42.9|156/202 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->181|PF01558|8e-13|39.4|160/178|POR 181: . * . . . .: 240 :Y :Sequence :$ :RP:PFM|16->181|PF01558|8e-13|39.4|160/178|POR