[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAL64945.1 paer1 AAL64945.1 "indolepyruvate ferredoxin oxidoreductase beta subunit"
MATSLVIVGVGGQGVLTLARWIGEAALAEGYDVRIAEVHGMSQRGGSVEVHVRYGKDIYA
PIVEEGGADYVIALEALEALRAYKYLKRGGELIVNRRVIQPPGNWLEEEEVFKAILTSGL
KSYIVPCFDIAIELGSPLYENAVMLGFFSQLAGLPMPPSLDERNREAFRRGALVYNSLAP
Y
//